PDB entry 6g3x

View 6g3x on RCSB PDB site
Description: Native Structure of the mouse 8-oxoguanine DNA Glycosylase mOGG1
Class: DNA binding protein
Keywords: N-glycosylase, DNA lyase, DNA BINDING PROTEIN
Deposited on 2018-03-26, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-glycosylase/DNA lyase
    Species: Mus musculus [TaxId:10090]
    Gene: OGG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08760 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d6g3xa1, d6g3xa2, d6g3xa3
  • Chain 'B':
    Compound: N-glycosylase/DNA lyase
    Species: Mus musculus [TaxId:10090]
    Gene: OGG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08760 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6g3xb1, d6g3xb2, d6g3xb3
  • Chain 'C':
    Compound: N-glycosylase/DNA lyase
    Species: Mus musculus [TaxId:10090]
    Gene: OGG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O08760 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6g3xc1, d6g3xc2, d6g3xc3
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g3xA (A:)
    gshmrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtlt
    qtedqlyctvyrgddsqvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkf
    qgvrllrqdpteclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpnlhal
    agpeaethlrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvg
    akvadciclmaldkpqavpvdvhvwqiahrdygwhpktsqakgpsplankelgnffrnlw
    gpyagwaqavlfsadlrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g3xA (A:)
    hmrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtltqt
    edqlyctvyrgddsqvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkfqg
    vrllrqdpteclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpnlhalag
    peaethlrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvgak
    vadciclmaldkpqavpvdvhvwqiahrdygwhpktsqapsplankelgnffrnlwgpya
    gwaqavlfsadlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g3xB (B:)
    gshmrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtlt
    qtedqlyctvyrgddsqvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkf
    qgvrllrqdpteclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpnlhal
    agpeaethlrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvg
    akvadciclmaldkpqavpvdvhvwqiahrdygwhpktsqakgpsplankelgnffrnlw
    gpyagwaqavlfsadlrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g3xB (B:)
    gshmrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtlt
    qtedqlyctvyrgddsqvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkf
    qgvrllrqdpteclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpnlhal
    agpeaethlrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvg
    akvadciclmaldkpqavpvdvhvwqiahrdygwhpktgpsplankelgnffrnlwgpya
    gwaqavlfsadlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6g3xC (C:)
    gshmrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtlt
    qtedqlyctvyrgddsqvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkf
    qgvrllrqdpteclfsficssnnniaritgmverlcqafgprliqlddvtyhgfpnlhal
    agpeaethlrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvg
    akvadciclmaldkpqavpvdvhvwqiahrdygwhpktsqakgpsplankelgnffrnlw
    gpyagwaqavlfsadlrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g3xC (C:)
    gshmrhrtlssspalwasipcprselrldlvlasgqsfrwkeqspahwsgvladqvwtlt
    qtedqlyctvyrgddvsrptleeletlhkyfqldvslaqlyshwasvdshfqrvaqkfqg
    vrllrqdpteclfsficssnniaritgmverlcqafgprliqlddvtyhgfpnlhalagp
    eaethlrklglgyraryvrasakaileeqggpawlqqlrvapyeeahkalctlpgvgakv
    adciclmaldkpqavpvdvhvwqiahrdygwhpktsqagpsplankelgnffrnlwgpya
    gwaqavlfsadl