PDB entry 6g31

View 6g31 on RCSB PDB site
Description: Crystal structure of human geranylgeranyl diphosphate synthase mutant D188Y bound to zoledronate
Class: transferase
Keywords: geranylgeranyl diphosphate synthase, mevalonate pathway, prenyltransferase, GGPPS, bisphosphonates, TRANSFERASE
Deposited on 2018-03-24, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749
      • conflict (115)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d6g31a_
  • Chain 'B':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749
      • conflict (115)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d6g31b_
  • Chain 'C':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749
      • conflict (115)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d6g31c_
  • Chain 'D':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749
      • conflict (115)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d6g31d_
  • Chain 'E':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749
      • conflict (115)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d6g31e_
  • Chain 'F':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749
      • conflict (115)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d6g31f_
  • Chain 'G':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749
      • conflict (115)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d6g31g_
  • Chain 'H':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749
      • conflict (115)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d6g31h_
  • Chain 'I':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749
      • conflict (115)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d6g31i_
  • Chain 'J':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749
      • conflict (115)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d6g31j_
  • Chain 'K':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749
      • conflict (115)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d6g31k_
  • Chain 'L':
    Compound: Geranylgeranyl pyrophosphate synthase
    Species: Homo sapiens [TaxId:9606]
    Gene: GGPS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95749
      • conflict (115)
      • engineered mutation (194)
    Domains in SCOPe 2.07: d6g31l_
  • Heterogens: ZOL, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g31A (A:)
    gsgsgsgmektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievt
    emlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavk
    lftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedl
    kpllntlglffqirydyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqni
    lrqrtenidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlsk
    mfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g31A (A:)
    qetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllid
    diednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllelhq
    gqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglff
    qirydyanlhsksfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhy
    ledvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g31B (B:)
    gsgsgsgmektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievt
    emlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavk
    lftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedl
    kpllntlglffqirydyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqni
    lrqrtenidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlsk
    mfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g31B (B:)
    etvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllidd
    iednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllelhqg
    qgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffq
    irydyanlhssfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhyle
    dvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6g31C (C:)
    gsgsgsgmektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievt
    emlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavk
    lftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedl
    kpllntlglffqirydyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqni
    lrqrtenidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlsk
    mfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g31C (C:)
    tqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnaslli
    ddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllelh
    qgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglf
    fqirydyanlhsnksfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycv
    hyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6g31D (D:)
    gsgsgsgmektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievt
    emlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavk
    lftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedl
    kpllntlglffqirydyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqni
    lrqrtenidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlsk
    mfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g31D (D:)
    etvqrillepykyllqlpgtklsqafnhwlkvpedklqiiievtemlhnaslliddiedn
    sklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllelhqgqgld
    iywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffqiryd
    yanlhsksfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhyledvg
    sfeytrntlkeleakaykqidarggnpelvalvkhlskmf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6g31E (E:)
    gsgsgsgmektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievt
    emlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavk
    lftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedl
    kpllntlglffqirydyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqni
    lrqrtenidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlsk
    mfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g31E (E:)
    qetvqrillepykyllqlafnhwlkvpedklqiiievtemlhnaslliddiednsklrrg
    fpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllelhqgqgldiywrdn
    ytcpteeeykamvlqktgglfglavglmqlfsdykntlglffqirydyanlhsfcedlte
    gkfsfptihaiwsrptqvqnilrqrtenidikkycvhygsfeytrntlkeleakpelval
    vkhlskmfk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6g31F (F:)
    gsgsgsgmektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievt
    emlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavk
    lftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedl
    kpllntlglffqirydyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqni
    lrqrtenidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlsk
    mfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g31F (F:)
    etvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllidd
    iednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllelhqg
    qgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffq
    irydyanlhsksfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhyl
    edvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6g31G (G:)
    gsgsgsgmektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievt
    emlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavk
    lftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedl
    kpllntlglffqirydyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqni
    lrqrtenidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlsk
    mfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g31G (G:)
    ktqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasll
    iddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllel
    hqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykpllntlglffqi
    rydyanlhsfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhyledv
    gsfeytrntlkeleakaykqidarggnpelvalvkhlskmf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6g31H (H:)
    gsgsgsgmektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievt
    emlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavk
    lftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedl
    kpllntlglffqirydyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqni
    lrqrtenidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlsk
    mfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g31H (H:)
    etvqrillepykyllqlpqvrtklsqafnhwlkvpedklqiiievtemlhnaslliddie
    dnsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllelhqgqg
    ldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffqir
    ydyanlhsfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhyledvg
    sfeytrntlkeleakaykqidarggnpelvalvkhlskmfk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6g31I (I:)
    gsgsgsgmektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievt
    emlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavk
    lftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedl
    kpllntlglffqirydyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqni
    lrqrtenidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlsk
    mfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g31I (I:)
    qetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllid
    diednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllelhq
    gqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglff
    qirydyanlksfcedltegkfsfptihaiwsrpevqnilrqrtenidikkycvhyledvg
    sfeytrntlkeleakaykqidgnpelvalvkhlskm
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6g31J (J:)
    gsgsgsgmektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievt
    emlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavk
    lftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedl
    kpllntlglffqirydyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqni
    lrqrtenidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlsk
    mfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g31J (J:)
    etvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllidd
    iednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllelhqg
    qgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffq
    irydyanlhsksfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhyl
    edvgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6g31K (K:)
    gsgsgsgmektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievt
    emlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavk
    lftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedl
    kpllntlglffqirydyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqni
    lrqrtenidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlsk
    mfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g31K (K:)
    qetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllid
    diednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllelhq
    gqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykkpllntlglffqir
    ydyanlhssfcedltegkfsfptihaiwsrpeqvqnilrqrtenidikkycvhyledvgy
    trntlkeleakaykqpelvalvkhlskmf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6g31L (L:)
    gsgsgsgmektqetvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievt
    emlhnaslliddiednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavk
    lftrqllelhqgqgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedl
    kpllntlglffqirydyanlhskeysenksfcedltegkfsfptihaiwsrpestqvqni
    lrqrtenidikkycvhyledvgsfeytrntlkeleakaykqidarggnpelvalvkhlsk
    mfkeene
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g31L (L:)
    etvqrillepykyllqlpgkqvrtklsqafnhwlkvpedklqiiievtemlhnasllidd
    iednsklrrgfpvahsiygipsvinsanyvyflglekvltldhqdavklftrqllelhqg
    qgldiywrdnytcpteeeykamvlqktgglfglavglmqlfsdykedlkpllntlglffq
    irydyanlhsfcedltegkfsfptihaiwsrpestqvqnilrqrtenidikkycvhyled
    vgsfeytrntlkeleakaykqidarggnpelvalvkhlskmfk