PDB entry 6g2v

View 6g2v on RCSB PDB site
Description: Crystal structure of the p97 D2 domain in a helical split-washer conformation
Class: hydrolase
Keywords: ATPase, p97, protein degradation, hydrolase
Deposited on 2018-03-23, released 2019-04-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-10, with a file datestamp of 2019-04-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Homo sapiens [TaxId:9606]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g2va_
  • Heterogens: MPD, DMS, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g2vA (A:)
    gpgsalretvvevpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfyg
    ppgcgktllakaianecqanfisikgpelltseanvreifdkarqaapcvlffdeldsia
    kaadrvinqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrv
    ailkanlrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrerevp
    eirrdhfeeamrfarrsvsdndirkyemfaqtlqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g2vA (A:)
    vvevpqvtwediggledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktll
    akaianecqanfisikgpelltseanvreifdkarqaapcvlffdeldsiakaadrvinq
    iltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrk
    spvakdvdleflakmtngfsgadlteicqracklairesieseirrerevpeirrdhfee
    amrfarrsvsdndirkyemfaqtlqq