PDB entry 6g1u

View 6g1u on RCSB PDB site
Description: Crystal structure of Torpedo Californica acetylcholinesterase in complex with 9-Amino-6-chloro-1,2,3,4-tetrahydro-10-methylacridin-10-ium
Class: hydrolase
Keywords: Torpedo Californica acetylcholinesterase, AD, alzheimer disease, HYDROLASE
Deposited on 2018-03-22, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholinesterase
    Species: Tetronarce californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g1ua_
  • Chain 'B':
    Compound: acetylcholinesterase
    Species: Tetronarce californica [TaxId:7787]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g1ub_
  • Heterogens: NAG, PEG, E1K, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g1uA (A:)
    mnllvtsslgvllhlvvlcqaddhsellvntksgkvmgtrvpvlsshisaflgipfaepp
    vgnmrfrrpepkkpwsgvwnastypnncqqyvdeqfpgfsgsemwnpnremsedclylni
    wvpsprpksttvmvwiygggfysgsstldvyngkylayteevvlvslsyrvgafgflalh
    gsqeapgnvglldqrmalqwvhdniqffggdpktvtifgesaggasvgmhilspgsrdlf
    rrailqsgspncpwasvsvaegrrravelgrnlncnlnsdeelihclrekkpqelidvew
    nvlpfdsifrfsfvpvidgeffptslesmlnsgnfkktqillgvnkdegsffllygapgf
    skdseskisredfmsgvklsvphandlgldavtlqytdwmddnngiknrdglddivgdhn
    vicplmhfvnkytkfgngtylyffnhrasnlvwpewmgvihgyeiefvfglplvkelnyt
    aeeealsrrimhywatfaktgnpnephsqeskwplfttkeqkfidlntepmkvhqrlrvq
    mcvfwnqflpkllnatacdgelsssgtssskgiifyvlfsilylif
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g1uA (A:)
    sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
    pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
    sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
    iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
    ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
    slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
    ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
    nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
    ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllnat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g1uB (B:)
    mnllvtsslgvllhlvvlcqaddhsellvntksgkvmgtrvpvlsshisaflgipfaepp
    vgnmrfrrpepkkpwsgvwnastypnncqqyvdeqfpgfsgsemwnpnremsedclylni
    wvpsprpksttvmvwiygggfysgsstldvyngkylayteevvlvslsyrvgafgflalh
    gsqeapgnvglldqrmalqwvhdniqffggdpktvtifgesaggasvgmhilspgsrdlf
    rrailqsgspncpwasvsvaegrrravelgrnlncnlnsdeelihclrekkpqelidvew
    nvlpfdsifrfsfvpvidgeffptslesmlnsgnfkktqillgvnkdegsffllygapgf
    skdseskisredfmsgvklsvphandlgldavtlqytdwmddnngiknrdglddivgdhn
    vicplmhfvnkytkfgngtylyffnhrasnlvwpewmgvihgyeiefvfglplvkelnyt
    aeeealsrrimhywatfaktgnpnephsqeskwplfttkeqkfidlntepmkvhqrlrvq
    mcvfwnqflpkllnatacdgelsssgtssskgiifyvlfsilylif
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g1uB (B:)
    sellvntksgkvmgtrvpvlsshisaflgipfaeppvgnmrfrrpepkkpwsgvwnasty
    pnncqqyvdeqfpgfsgsemwnpnremsedclylniwvpsprpksttvmvwiygggfysg
    sstldvyngkylayteevvlvslsyrvgafgflalhgsqeapgnvglldqrmalqwvhdn
    iqffggdpktvtifgesaggasvgmhilspgsrdlfrrailqsgspncpwasvsvaegrr
    ravelgrnlncnlnsdeelihclrekkpqelidvewnvlpfdsifrfsfvpvidgeffpt
    slesmlnsgnfkktqillgvnkdegsffllygapgfskdseskisredfmsgvklsvpha
    ndlgldavtlqytdwmddnngiknrdglddivgdhnvicplmhfvnkytkfgngtylyff
    nhrasnlvwpewmgvihgyeiefvfglplvkelnytaeeealsrrimhywatfaktgnpn
    ephsqeskwplfttkeqkfidlntepmkvhqrlrvqmcvfwnqflpkllna