PDB entry 6g13

View 6g13 on RCSB PDB site
Description: C-terminal domain of MERS-CoV nucleocapsid
Class: viral protein
Keywords: Nucleocapsid, RNA binding protein, MERS, coronavirus, CTD, VIRAL PROTEIN
Deposited on 2018-03-20, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoprotein
    Species: Middle East respiratory syndrome-related coronavirus [TaxId:1335626]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g13a_
  • Chain 'B':
    Compound: nucleoprotein
    Species: Middle East respiratory syndrome-related coronavirus [TaxId:1335626]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g13b_
  • Chain 'C':
    Compound: nucleoprotein
    Species: Middle East respiratory syndrome-related coronavirus [TaxId:1335626]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g13c_
  • Chain 'D':
    Compound: nucleoprotein
    Species: Middle East respiratory syndrome-related coronavirus [TaxId:1335626]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6g13d_
  • Heterogens: TMO, PEG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g13A (A:)
    hgtkkdaaaaknkmrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqi
    aelaptasafmgmsqfklthqnnddhgnpvyflrysgaikldpknpnynkwlelleqnid
    ayktfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g13A (A:)
    mrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqiaelaptasafmgm
    sqfklthqnnddgnpvyflrysgaikldpknpnynkwlelleqnidayktfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g13B (B:)
    hgtkkdaaaaknkmrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqi
    aelaptasafmgmsqfklthqnnddhgnpvyflrysgaikldpknpnynkwlelleqnid
    ayktfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g13B (B:)
    kmrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqiaelaptasafmg
    msqfklthqnnddgnpvyflrysgaikldpknpnynkwlelleqnidayktfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6g13C (C:)
    hgtkkdaaaaknkmrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqi
    aelaptasafmgmsqfklthqnnddhgnpvyflrysgaikldpknpnynkwlelleqnid
    ayktfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g13C (C:)
    kmrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqiaelaptasafmg
    msqfklthqnnddgnpvyflrysgaikldpknpnynkwlelleqnidayktfp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6g13D (D:)
    hgtkkdaaaaknkmrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqi
    aelaptasafmgmsqfklthqnnddhgnpvyflrysgaikldpknpnynkwlelleqnid
    ayktfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g13D (D:)
    nkmrhkrtstksfnmvqafglrgpgdlqgnfgdlqlnklgtedprwpqiaelaptasafm
    gmsqfklthqnnddgnpvyflrysgaikldpknpnynkwlelleqnidayktfp