PDB entry 6g07

View 6g07 on RCSB PDB site
Description: rorgt (264-518;c455s) in complex with inverse agonist "cpd-9" and rip140 peptide at 1.66a
Class: transcription
Keywords: fbs, nuclear hormone receptor, ligand binding domain, inverse agonist, transcription
Deposited on 2018-03-16, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (193)
    Domains in SCOPe 2.07: d6g07a_
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (193)
    Domains in SCOPe 2.07: d6g07b_
  • Chain 'C':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (193)
    Domains in SCOPe 2.07: d6g07c_
  • Chain 'D':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449
      • engineered mutation (193)
    Domains in SCOPe 2.07: d6g07d_
  • Chain 'P':
    Compound: Nuclear receptor-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: Nuclear receptor-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Nuclear receptor-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: Nuclear receptor-interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6g07A (A:)
    gpyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerca
    hhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegk
    yggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveq
    lqynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafppl
    ykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g07A (A:)
    yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
    elfst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6g07B (B:)
    gpyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerca
    hhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegk
    yggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveq
    lqynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafppl
    ykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g07B (B:)
    yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
    elfst
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6g07C (C:)
    gpyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerca
    hhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegk
    yggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveq
    lqynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafppl
    ykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g07C (C:)
    yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
    elfste
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6g07D (D:)
    gpyaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwerca
    hhlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegk
    yggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveq
    lqynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafppl
    ykelfstetespvglsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6g07D (D:)
    yaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahh
    lteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyg
    gmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlq
    ynlelafhhhlskthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyk
    elfst
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.