PDB entry 6fzd

View 6fzd on RCSB PDB site
Description: Crystal Structure of lipase from Geobacillus stearothermophilus T6 variant L184F/A187F/L360F
Class: hydrolase
Keywords: lipase, methanol, organic solvent, HYDROLASE
Deposited on 2018-03-14, released 2018-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-17, with a file datestamp of 2018-10-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipase
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93A71 (0-385)
      • engineered mutation (180)
      • engineered mutation (183)
      • conflict (319)
      • engineered mutation (356)
      • expression tag (386-391)
    Domains in SCOPe 2.07: d6fzda1, d6fzda2
  • Heterogens: ZN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fzdA (A:)
    srandapivllhgftgwgreemfgfkywggvrgdieqwlndngyrtytlavgplssnwdr
    aceayaqlvggtvdygaahaakhgharfgrtypgllpelkrggrihiiahsqggqtarml
    vsllengsqeereyakahnvslsplfegghhfvlsvttiatphdgttlvnmvdftdrffd
    fqkfvlkaaavasnvpytsqvydfkldqwglrrqpgesfdqyferlkrspvwtstdtary
    dlsvpgaeklnqwvkaspntyylsfatertyrgaltgnyypelgmnafsavvcapflgsy
    rnatlgiddrwlendgivnafsmngpkrgstdrivpydgtikkgvwndmgtynvdhfevi
    gvdpnplfdirafylrlaeqlaslqphhhhhh