PDB entry 6fys

View 6fys on RCSB PDB site
Description: Structure of single domain antibody SD83
Class: viral protein
Keywords: Influenza, single domain antibody, hemagglutinin, VIRAL PROTEIN
Deposited on 2018-03-12, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Single domain antibody SD83
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYS
  • Chain 'B':
    Compound: Single domain antibody SD83
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYS
  • Chain 'C':
    Compound: Single domain antibody SD83
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYS
  • Chain 'D':
    Compound: Single domain antibody SD83
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYS
  • Chain 'E':
    Compound: Single domain antibody SD83
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYS
    Domains in SCOPe 2.07: d6fyse_
  • Chain 'F':
    Compound: Single domain antibody SD83
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYS
  • Chain 'G':
    Compound: Single domain antibody SD83
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYS
  • Chain 'H':
    Compound: Single domain antibody SD83
    Species: LAMA GLAMA [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FYS
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fysE (E:)
    evqlvesggglvqpggslrlscaatgftlenkaigwfrqtpgseregvlcisksgswtyy
    tdsmrgrftisrdnaentvylqmdslkpedtavyycatttaggglcwdgttfsrlasswg
    qgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fysE (E:)
    vqlvesggglvqpggslrlscaatgftlenkaigwfrqtpregvlcisksgswtyytrgr
    ftisrdnaentvylqmdslkpedtavyycatttaggglcwdgttfsrlasswgqgtqvtv
    s
    

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.