PDB entry 6fy0

View 6fy0 on RCSB PDB site
Description: Crystal structure of a V2-directed, RV144 vaccine-like antibody from HIV-1 infection, CAP228-16H, bound to a heterologous V2 peptide
Class: immune system
Keywords: Fab, HIV V2 peptide, IMMUNE SYSTEM
Deposited on 2018-03-10, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CAP45 V2 peptide
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY0 (Start-18)
  • Chain 'H':
    Compound: CAP228-16H Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY0 (0-End)
  • Chain 'I':
    Compound: CAP228-16H Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY0 (0-End)
  • Chain 'L':
    Compound: CAP228-16H Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY0
    Domains in SCOPe 2.07: d6fy0l1, d6fy0l2
  • Chain 'M':
    Compound: CAP228-16H Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY0
    Domains in SCOPe 2.07: d6fy0m1, d6fy0m2
  • Chain 'P':
    Compound: CAP45 V2 peptide
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FY0 (Start-18)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6fy0L (L:)
    syeltqppsvsvapgttatitcggvdigstlvhwyqqrpgqapllviyddsdrpsgiper
    fsgsnsgnmatltisrveagdeadyycqvwhstsavifgggtkltvlsqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fy0L (L:)
    yeltqppsvsvapgttatitcggvdigstlvhwyqqrpgqapllviyddsdrpsgiperf
    sgsnsgnmatltisrveagdeadyycqvwhstsavifgggtkltvlsqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvaptec
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6fy0M (M:)
    syeltqppsvsvapgttatitcggvdigstlvhwyqqrpgqapllviyddsdrpsgiper
    fsgsnsgnmatltisrveagdeadyycqvwhstsavifgggtkltvlsqpkaapsvtlfp
    psseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassyls
    ltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fy0M (M:)
    yeltqppsvsvapgttatitcggvdigstlvhwyqqrpgqapllviyddsdrpsgiperf
    sgsnsgnmatltisrveagdeadyycqvwhstsavifgggtkltvlsqpkaapsvtlfpp
    sseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaassylsl
    tpeqwkshrsyscqvthegstvektvap
    

  • Chain 'P':
    No sequence available.