PDB entry 6fuu

View 6fuu on RCSB PDB site
Description: Transcriptional regulator LmrR with bound heme
Class: DNA binding protein
Keywords: Artificial enzyme, Complex, Heme-based catalysis, Transcriptional regulator, Multi-drug resistance, DNA BINDING PROTEIN
Deposited on 2018-02-27, released 2018-05-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator PadR family
    Species: Lactococcus lactis subsp. cremoris [TaxId:1359]
    Gene: NCDO763_1045, VN96_2738
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6fuua_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6fuuA (A:)
maeipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekd
giissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseaiksrws
hpqfek

    Sequence, based on observed residues (ATOM records): (download) 
    >6fuuA (A:)
pkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekdgiis
sywgdgrrkyyrlteighenmrlafeswsrvdkiienlea