PDB entry 6fu2

View 6fu2 on RCSB PDB site
Description: ATP phosphoribosyltransferase (HisZG ATPPRT) from Psychrobacter arcticus in complex with PRPP and ATP
Class: transferase
Keywords: ATP phosphoribosyltransferase, HisZG, cold-adapted, transferase
Deposited on 2018-02-26, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.71 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP phosphoribosyltransferase regulatory subunit
    Species: Psychrobacter arcticus [TaxId:334543]
    Gene: hisZ, Psyc_0676
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: ATP phosphoribosyltransferase regulatory subunit
    Species: Psychrobacter arcticus [TaxId:334543]
    Gene: hisZ, Psyc_0676
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: ATP phosphoribosyltransferase
    Species: Psychrobacter arcticus [TaxId:334543]
    Gene: hisG, Psyc_1903
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fu2c_
  • Chain 'D':
    Compound: ATP phosphoribosyltransferase
    Species: Psychrobacter arcticus [TaxId:334543]
    Gene: hisG, Psyc_1903
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fu2d_
  • Heterogens: TRS, PRP, ATP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fu2C (C:)
    gmtevtnslptsgllneandeflgltlalskgrileetmpllraagvelledpeasrkli
    fptsnpnvrvlilrasdvptyvehgaadfgvagkdvllehganhvyelldlkiaqcklmt
    agvkdaplpnrrlriatkyvnvarayfasqgqqvdviklygsmelaplvglgdlivdvvd
    tgntlrangleardhicdvssrlivnqvsykrkfallepildsfknsinsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fu2C (C:)
    eflgltlalskgrileetmpllraagvelledpeasrklifptsnpnvrvlilrasdvpt
    yvehgaadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyv
    nvarayfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvs
    srlivnqvsykrkfallepildsfknsin
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fu2D (D:)
    gmtevtnslptsgllneandeflgltlalskgrileetmpllraagvelledpeasrkli
    fptsnpnvrvlilrasdvptyvehgaadfgvagkdvllehganhvyelldlkiaqcklmt
    agvkdaplpnrrlriatkyvnvarayfasqgqqvdviklygsmelaplvglgdlivdvvd
    tgntlrangleardhicdvssrlivnqvsykrkfallepildsfknsinsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fu2D (D:)
    flgltlalskgrileetmpllraagvelledpeasrklifptsnpnvrvlilrasdvpty
    vehgaadfgvagkdvllehganhvyelldlkiaqcklmtagvkdaplpnrrlriatkyvn
    varayfasqgqqvdviklygsmelaplvglgdlivdvvdtgntlrangleardhicdvss
    rlivnqvsykrkfallepildsfknsin