PDB entry 6fto

View 6fto on RCSB PDB site
Description: Crystal structure of the Chp2 chromoshadow domain in complex with N-terminal domain of chromatin remodeler Mit1
Class: replication
Keywords: chromoshadow domain, complex, chromatin remodeler, REPLICATION
Deposited on 2018-02-22, released 2019-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-27, with a file datestamp of 2019-03-22.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromo domain-containing protein 2
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42934 (1-65)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6ftoa_
  • Chain 'B':
    Compound: Chromo domain-containing protein 2
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O42934 (1-65)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d6ftob_
  • Chain 'C':
    Compound: Chromatin remodeling factor mit1
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9P793 (Start-80)
      • conflict (78)
  • Heterogens: HEZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ftoA (A:)
    mkppfqkkswedlvdcvktvqqldngkliakikwkngyvsthdniiihqkcplkiieyye
    ahikft
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ftoB (B:)
    mkppfqkkswedlvdcvktvqqldngkliakikwkngyvsthdniiihqkcplkiieyye
    ahikft
    

  • Chain 'C':
    No sequence available.