PDB entry 6fsw

View 6fsw on RCSB PDB site
Description: Structure of Archaeoglobus fulgidus SBDS protein at 1.9 Angstrom
Class: ribosomal protein
Keywords: SBDS, conformational flexibility, RIBOSOMAL PROTEIN
Deposited on 2018-02-20, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ribosome maturation protein SDO1-like protein
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: XD40_1041, XD48_1723
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A101DZV9 (Start-235)
      • conflict (61)
      • conflict (77)
    Domains in SCOPe 2.07: d6fswa1, d6fswa2, d6fswa3
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fswA (A:)
    ghmvsldkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakkgera
    svdelrkifgtddvfeiarkiilegevqitaeqrremleakrkqiinfisrntidprtna
    phppsrieraleeakvhidifksveaqvkdivkalkpilplkfeemeiaikippehtgra
    isalynfggvtreewqrdgswicvmripsgmygdlmdllgkvakgealtkvlrrig
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fswA (A:)
    sldkaviarlrkggeefevlvdpylardlkegkevnfedllaaeevfkdakkgerasvde
    lrkifgtddvfeiarkiilegevqitaeqrremleakrkqiinfisrntidprtnaphpp
    srieraleeakvhidifksveaqvkdivkalkpilplkfeemeiaikippehtgraisal
    ynfggvtreewqrdgswicvmripsgmygdlmdllgkvakgealtkvlrrig