PDB entry 6frn

View 6frn on RCSB PDB site
Description: Structure of F420H2 oxidase (FprA) co-crystallized with 10mM Tb-Xo4 and calcium chloride
Class: oxidoreductase
Keywords: protein nucleation, phasing, Tb-Xo4, crystallophore, OXIDOREDUCTASE
Deposited on 2018-02-16, released 2018-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: F420H2 oxidase (FprA)
    Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FRN (0-End)
    Domains in SCOPe 2.07: d6frna1, d6frna2
  • Chain 'B':
    Compound: F420H2 oxidase (FprA)
    Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FRN (0-End)
    Domains in SCOPe 2.07: d6frnb1, d6frnb2
  • Chain 'C':
    Compound: F420H2 oxidase (FprA)
    Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FRN (0-End)
    Domains in SCOPe 2.07: d6frnc1, d6frnc2
  • Chain 'D':
    Compound: F420H2 oxidase (FprA)
    Species: Methanothermococcus thermolithotrophicus [TaxId:2186]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FRN (0-End)
    Domains in SCOPe 2.07: d6frnd1, d6frnd2
  • Heterogens: FMN, CA, TB, GOL, PE4, 7MT, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6frnA (A:)
    mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
    wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
    slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
    qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
    pmkvigayqdfatgkckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnders
    eivkdildskafllgaptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggnggg
    tkvlaeklkecgfevldeyelyyvptedelekcynmgkrlavkvkemkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frnA (A:)
    mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
    wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
    slkgapfkvvkslesidlggktltflepdsmftlyaeegilfsndafgqhlcftqrfdhe
    ipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtdpmkvig
    ayqdfatgkckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnderseivkdi
    ldskafllgaptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggngggtkvlae
    klkecgfevldeyelyyvptedelekcynmgkrlavkvkemkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6frnB (B:)
    mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
    wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
    slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
    qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
    pmkvigayqdfatgkckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnders
    eivkdildskafllgaptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggnggg
    tkvlaeklkecgfevldeyelyyvptedelekcynmgkrlavkvkemkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frnB (B:)
    mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
    wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
    slkgapfkvvkslesidlggktltfleadsmftlyaeegilfsndafgqhlcftqrfdhe
    ipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtdpmkvig
    ayqdfatgkckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnderseivkdi
    ldskafllgaptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggngggtkvlae
    klkecgfevldeyelyyvptedelekcynmgkrlavkvkemkt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6frnC (C:)
    mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
    wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
    slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
    qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
    pmkvigayqdfatgkckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnders
    eivkdildskafllgaptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggnggg
    tkvlaeklkecgfevldeyelyyvptedelekcynmgkrlavkvkemkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frnC (C:)
    mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
    wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
    slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
    qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
    pmkvigayqdfatgkckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnders
    eivkdildskafllgaptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggnggg
    tkvlaeklkecgfevldeyelyyvptedelekcynmgkrlavkvkemkt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6frnD (D:)
    mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
    wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
    slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
    qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
    pmkvigayqdfatgkckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnders
    eivkdildskafllgaptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggnggg
    tkvlaeklkecgfevldeyelyyvptedelekcynmgkrlavkvkemkte
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frnD (D:)
    mkadavkiadgvywvgvldwdirmyhgytlngttynaylvfgddkvalidntypgtsaqm
    wgrikdacekegrefkidvivqnhvekdhsgalpeihkkfpeapiyctevaveglvkhfp
    slkgapfkvvkslesidlggktltfleapllhwpdsmftlyaeegilfsndafgqhlcft
    qrfdheipenilmdanqkfyanlitplsklvlkkfkevielgllekikmiapshgqiwtd
    pmkvigayqdfatgkckdkvtivydtmhgstqkmahafaegimsegvdvkmyflhnders
    eivkdildskafllgaptiydepfpsvgdliyylkglkfnrtglkrlalafgsmggnggg
    tkvlaeklkecgfevldeyelyyvptedelekcynmgkrlavkvkemkt