PDB entry 6frf

View 6frf on RCSB PDB site
Description: Crystal structure of CREBBP bromodomain complexd with PA10
Class: transferase
Keywords: Inhibitor, Bromodomain, Transferase
Deposited on 2018-02-15, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92793 (2-118)
      • expression tag (1)
    Domains in SCOPe 2.07: d6frfa1, d6frfa2
  • Chain 'B':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6frfb_
  • Chain 'C':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6frfc_
  • Chain 'D':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6frfd_
  • Heterogens: E3T, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6frfA (A:)
    smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
    krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frfA (A:)
    mrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstik
    rkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6frfB (B:)
    smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
    krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frfB (B:)
    ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkld
    tgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6frfC (C:)
    smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
    krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frfC (C:)
    ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkld
    tgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6frfD (D:)
    smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
    krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6frfD (D:)
    ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkld
    tgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg