PDB entry 6fr8

View 6fr8 on RCSB PDB site
Description: HA1.7 Human T-Cell Receptor specific for Influenza virus epitope PKYVKQNTLKLAT presented by Human Leukocyte Antigen HLA-DR0101
Class: immune system
Keywords: Human T Cell Receptor, Human Leukocute Antigen, Influenza Haemagglutinin epitope, 3D structure, IMMUNE SYSTEM
Deposited on 2018-02-15, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-Cell Receptor HA1.7 alpha Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FR8 (0-201)
    Domains in SCOPe 2.07: d6fr8a1, d6fr8a2
  • Chain 'B':
    Compound: T-Cell Receptor HA1.7 beta Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FR8 (0-240)
    Domains in SCOPe 2.07: d6fr8b1, d6fr8b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fr8A (A:)
    mqsvtqlgshvsvsegalvllrcnysssvppylfwyvqypnqglqlllkytsaatlvkgi
    ngfeaefkksetsfhltkpsahmsdaaeyfcavsespfgnekltfgtgtrltiipniqnp
    dpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavaw
    snksdfacanafnnsiipedtf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fr8B (B:)
    vkvtqssrylvkrtgekvflecvqdmdhenmfwyrqdpglglrliyfsydvkmkekgdip
    egysvsrekkerfslilesastnqtsmylcassstglpygytfgsgtrltvvedlnkvfp
    pevavfepseaeishtqkatlvclatgffpdhvelswwvngkevhsgvctdpqplkeqpa
    lndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    a