SCOPe 2.08: Structural Classification of Proteins

PDB entry 6fqj

View 6fqj on RCSB PDB site
Description: GluA2(flop) G724C ligand binding core dimer bound to ZK200775 at 2.50 Angstrom resolution
Class: membrane protein
Keywords: AMPAR receptor, Ligand binding domain, Competitive antagonist, Cross-linked dimer, MEMBRANE PROTEIN
Deposited on 2018-02-14, released 2019-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Glutamate receptor 2,Glutamate receptor 2
Species: Rattus norvegicus [TaxId:10116]
Gene: Gria2, Glur2
Database cross-references and differences (RAF-indexed):
- Uniprot P19491 (2-116)
  - linker (117-118)
- Uniprot P19491 (119-End)
  - conflict (211)
Domains in SCOPe 2.08: d6fqja_
Chain 'B':
Compound: Glutamate receptor 2,Glutamate receptor 2
Species: Rattus norvegicus [TaxId:10116]
Gene: Gria2, Glur2
Database cross-references and differences (RAF-indexed):
- Uniprot P19491 (Start-116)
  - linker (117-118)
- Uniprot P19491 (119-End)
  - conflict (211)
Domains in SCOPe 2.08: d6fqjb_
Chain 'C':
Compound: Glutamate receptor 2,Glutamate receptor 2
Species: Rattus norvegicus [TaxId:10116]
Gene: Gria2, Glur2
Database cross-references and differences (RAF-indexed):
- Uniprot P19491 (Start-116)
  - linker (117-118)
- Uniprot P19491 (119-End)
  - conflict (211)
Domains in SCOPe 2.08: d6fqjc_
Chain 'D':
Compound: Glutamate receptor 2,Glutamate receptor 2
Species: Rattus norvegicus [TaxId:10116]
Gene: Gria2, Glur2
Database cross-references and differences (RAF-indexed):
- Uniprot P19491 (2-116)
  - linker (117-118)
- Uniprot P19491 (119-End)
  - conflict (211)
Domains in SCOPe 2.08: d6fqjd_
Chain 'E':
Compound: Glutamate receptor 2,Glutamate receptor 2
Species: Rattus norvegicus [TaxId:10116]
Gene: Gria2, Glur2
Database cross-references and differences (RAF-indexed):
- Uniprot P19491 (Start-116)
  - linker (117-118)
- Uniprot P19491 (119-End)
  - conflict (211)
Domains in SCOPe 2.08: d6fqje_
Chain 'F':
Compound: Glutamate receptor 2,Glutamate receptor 2
Species: Rattus norvegicus [TaxId:10116]
Gene: Gria2, Glur2
Database cross-references and differences (RAF-indexed):
- Uniprot P19491 (Start-116)
  - linker (117-118)
- Uniprot P19491 (119-End)
  - conflict (211)
Domains in SCOPe 2.08: d6fqjf_
Chain 'G':
Compound: Glutamate receptor 2,Glutamate receptor 2
Species: Rattus norvegicus [TaxId:10116]
Gene: Gria2, Glur2
Database cross-references and differences (RAF-indexed):
- Uniprot P19491 (Start-116)
  - linker (117-118)
- Uniprot P19491 (119-End)
  - conflict (211)
Domains in SCOPe 2.08: d6fqjg_
Chain 'H':
Compound: Glutamate receptor 2,Glutamate receptor 2
Species: Rattus norvegicus [TaxId:10116]
Gene: Gria2, Glur2
Database cross-references and differences (RAF-indexed):
- Uniprot P19491 (Start-116)
  - linker (117-118)
- Uniprot P19491 (119-End)
  - conflict (211)
Domains in SCOPe 2.08: d6fqjh_
Heterogens: ZK1, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6fqjA (A:)
ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
vrkskgkyayllestmneyieqrkpcdtmkvcgnldskgygiatpkgsslgnavnlavlk
lneqglldklknkwwydkgecgsg