PDB entry 6fpo

View 6fpo on RCSB PDB site
Description: High resolution structure of native Hydrogenase (Hyd-1)
Class: oxidoreductase
Keywords: NiFe hydrogenase, Iron sulphur cluster, periplasm, hydrogen, OXIDOREDUCTASE
Deposited on 2018-02-11, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: Hydrogenase-1 large chain
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fpol_
  • Chain 'M':
    Compound: Hydrogenase-1 large chain
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fpom_
  • Chain 'S':
    Compound: Hydrogenase-1 small chain
    Species: Escherichia coli CFT073 [TaxId:199310]
    Gene: hyaA, c1113
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fpos_
  • Chain 'T':
    Compound: Hydrogenase-1 small chain
    Species: Escherichia coli CFT073 [TaxId:199310]
    Gene: hyaA, c1113
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fpot_
  • Heterogens: SF4, F3S, SF3, LMT, CL, FCO, NI, MG, LI, SO4, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6fpoL (L:)
    mstqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiil
    qgrdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhl
    vhfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlg
    ifrngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpca
    inidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkc
    vlsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndq
    vgrhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliay
    hkgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkng
    nlatastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprd
    pkgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpoL (L:)
    stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
    grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
    hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
    frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
    nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
    lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
    grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
    kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
    latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
    kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >6fpoM (M:)
    mstqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiil
    qgrdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhl
    vhfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlg
    ifrngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpca
    inidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkc
    vlsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndq
    vgrhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliay
    hkgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkng
    nlatastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprd
    pkgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpoM (M:)
    stqyetqgytinnagrrlvvdpitrieghmrcevnindqnvitnavscgtmfrgleiilq
    grdprdawafvericgvctgvhalasvyaiedaigikvpdnaniirnimlatlwchdhlv
    hfyqlagmdwidvldalkadprktselaqslsswpksspgyffdvqnrlkkfveggqlgi
    frngywghpqyklppeanlmgfahylealdfqreivkihavfggknphpnwivggmpcai
    nidesgavgavnmerlnlvqsiitrtadfinnvmipdalaigqfnkpwseigtglsdkcv
    lsygafpdiandfgeksllmpggavingdfnnvlpvdlvdpqqvqefvdhawyrypndqv
    grhpfdgitdpwynpgdvkgsdtniqqlneqeryswikaprwrgnamevgplartliayh
    kgdaatvesvdrmmsalnlplsgiqstlgrilcraheaqwaagklqyffdklmtnlkngn
    latastekwepatwptecrgvgfteaprgalghwaairdgkidlyqcvvpttwnasprdp
    kgqigayeaalmntkmaipeqpleilrtlhsfdpclacsth
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >6fpoS (S:)
    lenkpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevf
    ediitqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgc
    vqaarpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplm
    fygqrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvs
    fpiqsghgclgcaengfwdrgsfysrvvdipqmgthstadtvgltalgvvaaavgvhava
    savdqrrrhnqqptetehqpgnedkqarshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpoS (S:)
    kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
    itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
    arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
    qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
    qsghgclgcaengfwdrgsfysrv
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >6fpoT (T:)
    lenkpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevf
    ediitqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgc
    vqaarpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplm
    fygqrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvs
    fpiqsghgclgcaengfwdrgsfysrvvdipqmgthstadtvgltalgvvaaavgvhava
    savdqrrrhnqqptetehqpgnedkqarshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fpoT (T:)
    kpripvvwihglectcctesfirsahplakdvilslisldyddtlmaaagtqaeevfedi
    itqyngkyilavegnpplgeqgmfcissgrpfieklkraaagasaiiawgtcaswgcvqa
    arpnptqatpidkvitdkpiikvpgcppipdvmsaiitymvtfdrlpdvdrmgrplmfyg
    qrihdkcyrrahfdagefvqswdddaarkgyclykmgckgpttynacsstrwndgvsfpi
    qsghgclgcaengfwdrgsfysrv