PDB entry 6foh

View 6foh on RCSB PDB site
Description: X-ray structure of homo sapiens Fumarylacetoacetate hydrolase domain containing protein 1 (FAHD1) at 1.56A resolution.
Class: hydrolase/lyase
Keywords: FAHD 1, Fumarylacetoacetate hydrolase domain containing protein 1, Hydrolase/lyase, HYDROLASE-LYASE complex
Deposited on 2018-02-07, released 2018-11-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-07, with a file datestamp of 2018-11-02.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acylpyruvase FAHD1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FAHD1, C16orf36, YISKL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6foha_
  • Chain 'B':
    Compound: Acylpyruvase FAHD1, mitochondrial
    Species: Homo sapiens [TaxId:9606]
    Gene: FAHD1, C16orf36, YISKL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fohb_
  • Heterogens: CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fohA (A:)
    mgimaasrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspil
    mpaytrnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwt
    laksftascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskii
    tleegdiiltgtpkgvgpvkendeieagihglvsmtfkvekpey
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fohA (A:)
    asrplsrfwewgknivcvgrnyadsavlsepvlflkpstayapegspilmpaytrnlhhe
    lelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksftascpv
    safvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleegdiiltg
    tpkgvgpvkendeieagihglvsmtfkvekpey
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fohB (B:)
    mgimaasrplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspil
    mpaytrnlhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwt
    laksftascpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskii
    tleegdiiltgtpkgvgpvkendeieagihglvsmtfkvekpey
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fohB (B:)
    rplsrfwewgknivcvgrnyadhvremrsavlsepvlflkpstayapegspilmpaytrn
    lhhelelgvvmgkrcravpeaaamdyvggyalcldmtardvqdeckkkglpwtlaksfta
    scpvsafvpkekipdphklklwlkvngelrqegetssmifsipyiisyvskiitleegdi
    iltgtpkgvgpvkendeieagihglvsmtfkvekpey