PDB entry 6fno

View 6fno on RCSB PDB site
Description: Caldiarchaeum Subterraneum Ubiquitin:Rpn11-homolog complex, zinc soak
Class: hydrolase
Keywords: deubiquitination, deubiquitylation, JAMM protease, HYDROLASE
Deposited on 2018-02-04, released 2018-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 26S proteasome regulatory subunit N11-like protein
    Species: Candidatus Caldiarchaeum subterraneum [TaxId:311458]
    Gene: CSUB_C1473, HGMM_F04B03C04, HGMM_F21D07C20, HGMM_F30C12C32
    Database cross-references and differences (RAF-indexed):
    • Uniprot E6N8B9 (8-154)
      • expression tag (3-7)
  • Chain 'B':
    Compound: 26S proteasome regulatory subunit N11-like protein
    Species: Candidatus Caldiarchaeum subterraneum [TaxId:311458]
    Gene: CSUB_C1473, HGMM_F04B03C04, HGMM_F21D07C20, HGMM_F30C12C32
    Database cross-references and differences (RAF-indexed):
    • Uniprot E6N8B9 (8-154)
      • expression tag (3-7)
  • Chain 'C':
    Compound: Ubiquitin-like protein
    Species: Candidatus Caldiarchaeum subterraneum [TaxId:311458]
    Gene: CSUB_C1474, HGMM_F04B03C03, HGMM_F21D07C21, HGMM_F30C12C33
    Database cross-references and differences (RAF-indexed):
    • Uniprot E6N8B8 (26-103)
      • expression tag (14-25)
    Domains in SCOPe 2.08: d6fnoc1, d6fnoc2
  • Chain 'D':
    Compound: Ubiquitin-like protein
    Species: Candidatus Caldiarchaeum subterraneum [TaxId:311458]
    Gene: CSUB_C1474, HGMM_F04B03C03, HGMM_F21D07C21, HGMM_F30C12C33
    Database cross-references and differences (RAF-indexed):
    • Uniprot E6N8B8 (26-103)
      • expression tag (15-25)
    Domains in SCOPe 2.08: d6fnod1, d6fnod2
  • Heterogens: ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >6fnoC (C:)
mkhhhhhhpmsdydipttenlyfqghmkikivpavgggsplelevapnatvgavrtkvca
mkklppdttrltykgralkdtetleslgvadgdkfvlitrtvgg

    Sequence, based on observed residues (ATOM records): (download) 
    >6fnoC (C:)
ipttenlyfqghmkikivpavgggsplelevapnatvgavrtkvcamkklppdttrltyk
gralkdtetleslgvadgdkfvlitrtvgg

  • Chain 'D':
    Sequence, based on SEQRES records: (download) 
    >6fnoD (D:)
mkhhhhhhpmsdydipttenlyfqghmkikivpavgggsplelevapnatvgavrtkvca
mkklppdttrltykgralkdtetleslgvadgdkfvlitrtvgg

    Sequence, based on observed residues (ATOM records): (download) 
    >6fnoD (D:)
pttenlyfqghmkikivpavgggsplelevapnatvgavrtkvcamkklppdttrltykg
ralkdtetleslgvadgdkfvlitrtvgg