PDB entry 6fn8

View 6fn8 on RCSB PDB site
Description: Domain II of the HUMAN COPPER CHAPERONE FOR SUPEROXIDE DISMUTASE at 1.55 A resolution
Class: chaperone
Keywords: ImgG-like, copper-chaperone, zinc-binding, protein maturation, CHAPERONE
Deposited on 2018-02-02, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper chaperone for superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: CCS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fn8a_
  • Chain 'B':
    Compound: copper chaperone for superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: CCS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fn8b_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fn8A (A:)
    nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc
    gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege
    ddlgrgghplskitgnsgerlacgiiarsagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fn8A (A:)
    nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc
    gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege
    ddlgrgghplskitgnsgerlacgiiarsag
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fn8B (B:)
    nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc
    gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege
    ddlgrgghplskitgnsgerlacgiiarsagl