PDB entry 6fme

View 6fme on RCSB PDB site
Description: Structure of sucrose phosphorylase from Bifidobacterium adolescentis bound to glycosylated resveratrol
Class: transferase
Keywords: sucrose phosphorylase, resveratrol, enzyme design, transferase
Deposited on 2018-01-31, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sucrose phosphorylase
    Species: Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) [TaxId:367928]
    Gene: sucP, spl, BAD_0078
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0ZZH6 (1-504)
      • expression tag (0)
      • engineered mutation (345)
      • expression tag (505)
    Domains in SCOPe 2.07: d6fmea1, d6fmea2, d6fmea3, d6fmea4
  • Chain 'B':
    Compound: sucrose phosphorylase
    Species: Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) [TaxId:367928]
    Gene: sucP, spl, BAD_0078
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0ZZH6 (1-504)
      • expression tag (0)
      • engineered mutation (345)
    Domains in SCOPe 2.07: d6fmeb1, d6fmeb2, d6fmeb3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fmeA (A:)
    amknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidht
    kvderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvf
    pngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifd
    qmaashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykk
    qveiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigs
    dqldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyfvnstyysalgcndq
    hyiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpv
    vkalnalakfrneldafdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpv
    amlewedsagdhrsddlianppvvaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fmeB (B:)
    amknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidht
    kvderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvf
    pngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifd
    qmaashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykk
    qveiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigs
    dqldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyfvnstyysalgcndq
    hyiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpv
    vkalnalakfrneldafdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpv
    amlewedsagdhrsddlianppvvaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fmeB (B:)
    amknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidht
    kvderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvf
    pngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifd
    qmaashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykk
    qveiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigs
    dqldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyfvnstyysalgcndq
    hyiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpv
    vkalnalakfrneldafdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpv
    amlewedsagdhrsddlianppvva