PDB entry 6fk5

View 6fk5 on RCSB PDB site
Description: Structure of 3' phosphatase NExo (D146N) from Neisseria bound to DNA substrate in presence of magnesium ion
Class: DNA binding protein
Keywords: 3' phosphatase, base excision DNA repair, Mg2+, DNA BINDING PROTEIN
Deposited on 2018-01-23, released 2018-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-31, with a file datestamp of 2018-10-26.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NExo D146N
    Species: Neisseria meningitidis MC58 [TaxId:122586]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0A8F5K9 (2-257)
      • expression tag (1)
      • conflict (147)
    Domains in SCOPe 2.07: d6fk5a1, d6fk5a2
  • Chain 'B':
    Compound: DNA (5'-d(p*cp*tp*ap*gp*cp*gp*ap*ap*gp*cp*tp*ap*gp*a)-3')
    Species: other sequences [TaxId:28384]
  • Heterogens: MG, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fk5A (A:)
    gamkittwnvnslnvrlpqvqnlladnppdilvlqelkldqdkfpaaalqmmgwhcvwsg
    qktyngvaivsrsvpqdvhfglpalpddpqrrviaatvsgvrvinvycvngealdspkfk
    ykeqwfaaltefvrdemtrhgklvllgnfniapadadcydpekwhekihcssverqwfqn
    lldlgltdslrqvhpegafytwfdyrgamfqrklglridhilvspamaaalkdvrvdlet
    ralerpsdhapvtaefdw
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fk5A (A:)
    amkittwnvnslnvrlpqvqnlladnppdilvlqelkldqdkfpaaalqmmgwhcvwsgq
    ktyngvaivsrsvpqdvhfglpalpddpqrrviaatvsgvrvinvycvngealdspkfky
    keqwfaaltefvrdemtrhgklvllgnfniapadadcydpekwhekihcssverqwfqnl
    ldlgltdslrqvhpegafytwfdyrgamfqrklglridhilvspamaaalkdvrvdletr
    alerpsdhapvtaefdw
    

  • Chain 'B':
    No sequence available.