PDB entry 6fj7

View 6fj7 on RCSB PDB site
Description: Caldiarchaeum Subterraneum Ubiquitin
Class: protein binding
Keywords: ubiquitination, ubiquitylation, protein binding
Deposited on 2018-01-21, released 2018-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-07-25, with a file datestamp of 2018-07-20.
Experiment type: XRAY
Resolution: 1.05 Å
R-factor: N/A
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin-like protein
  Species: Candidatus Caldiarchaeum subterraneum [TaxId:311458]
  Gene: CSUB_C1474, HGMM_F04B03C03, HGMM_F21D07C21, HGMM_F30C12C33
  Database cross-references and differences (RAF-indexed):
  • Uniprot E6N8B8 (2-79)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d6fj7a1, d6fj7a2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6fj7A (A:)
  ghmkikivpavgggsplelevapnatvgavrtkvcamkklppdttrltykgralkdtetl
  eslgvadgdkfvlitrtvgg