PDB entry 6fip

View 6fip on RCSB PDB site
Description: Solution NMR structure of Pseudomonas aeruginosa TonB CTD
Class: transport protein
Keywords: TonB, TonB box, Gram-negative bacteria, TRANSPORT PROTEIN
Deposited on 2018-01-19, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein tonB
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: tonB, PA5531
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51368 (3-98)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d6fipa1, d6fipa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fipA (A:)
    shmgslndsdikplrmdppvyprmaqargiegrvkvlftitsdgriddiqvlesvpsrmf
    drevrqamakwrfeprvsggkivarqatkmfffkiekrr