PDB entry 6fio

View 6fio on RCSB PDB site
Description: DDR1, 2-[1'-(1H-indazole-5-carbonyl)-4-methyl-2-oxospiro[indole-3,4'-piperidine]-1-yl]-N-(2,2,2-trifluoroethyl)acetamide, 1.990A, P6522, Rfree=27.7%
Class: transferase
Keywords: rtk, receptor tyrosine kinase, collagen, discoidin domain;, transferase
Deposited on 2018-01-19, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: epithelial discoidin domain-containing receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR1, CAK, EDDR1, NEP, NTRK4, PTK3A, RTK6, TRKE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fioa_
  • Heterogens: DJH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fioA (A:)
    pgavgdgpprvdfprsrlrfkeklgegqfgevhlcevdspqdlvsldfplnvrkghpllv
    avkilrpdatknarndflkevkimsrlkdpniirllgvcvqddplcmitdymengdlnqf
    lsahqledkaaegapgdptisypmllhvaaqiasgmrylatlnfvhrdlatrnclvgenf
    tikiadfgmsrnlyagdyyrvqgravlpirwmawecilmgkfttasdvwafgvtlwevlm
    lcraqpfgqltdeqvienageffrdqgrqvylsrppacpqglyelmlrcwsreseqrppf
    sqlhrflaedalntvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fioA (A:)
    dgpprvdfprsrlrfkeklgegqfgevhlcevdspqdlvsldfplnvrkghpllvavkil
    rpdatknarndflkevkimsrlkdpniirllgvcvqddplcmitdymengdlnqflsahq
    ledkaaegadptisypmllhvaaqiasgmrylatlnfvhrdlatrnclvgenftikiadf
    gmsrnlyagdyyrvqgravlpirwmawecilmgkfttasdvwafgvtlwevlmlcraqpf
    gqltdeqvienageffrdqgrqvylsrppacpqglyelmlrcwsreseqrppfsqlhrfl
    aedalnt