PDB entry 6fhp

View 6fhp on RCSB PDB site
Description: DAIP in complex with a C-terminal fragment of thermolysin
Class: antimicrobial protein
Keywords: Dispase autolysis-inducing protein; neutral metalloproteases; protease twisting; conformation analysis, ANTIMICROBIAL PROTEIN
Deposited on 2018-01-15, released 2018-09-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-09-12, with a file datestamp of 2018-09-07.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dispase autolysis-inducing protein
    Species: Streptomyces mobaraensis [TaxId:35621]
    Gene: daip
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: dispase autolysis-inducing protein
    Species: Streptomyces mobaraensis [TaxId:35621]
    Gene: daip
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: thermolysin
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fhpc_
  • Chain 'D':
    Compound: thermolysin
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fhpd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fhpC (C:)
    vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg
    vk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fhpC (C:)
    gigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavgv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fhpD (D:)
    vvgigrdklgkifyraltqyltptsnfsqlraaavqsatdlygstsqevasvkqafdavg
    vk