PDB entry 6fgq

View 6fgq on RCSB PDB site
Description: Ligand complex of RORg LBD
Class: transcription
Keywords: RAR-related Orphan Receptor-g (RORg), TRANSCRIPTION, RORG LIGAND, STRUCTURE-BASED DESIGN
Deposited on 2018-01-11, released 2018-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-22, with a file datestamp of 2018-08-17.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51449 (22-End)
      • expression tag (20-21)
    Domains in SCOPe 2.07: d6fgqa1, d6fgqa2
  • Chain 'B':
    Compound: Nuclear receptor ROR-gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: RORC, NR1F3, RORG, RZRG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fgqb_
  • Heterogens: D9N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fgqA (A:)
    mhnhnhnhnhnhnggenlyfqgaslteiehlvqsvcksyretcqlrledllrqrsnifsr
    eevtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvl
    vrmcraynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialyta
    lvlinahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhver
    lqifqhlhpivvqaafpplykelfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgqA (A:)
    qgaslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercah
    hlteaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegky
    ggmelfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveql
    qynlelafhhhlckthrqsilaklppkgklrslchverlqifqhlhpiv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fgqB (B:)
    mhnhnhnhnhnhnggenlyfqgaslteiehlvqsvcksyretcqlrledllrqrsnifsr
    eevtgyqrksmwemwercahhlteaiqyvvefakrlsgfmelcqndqivllkagamevvl
    vrmcraynadnrtvffegkyggmelfralgcselissifdfshslsalhfsedeialyta
    lvlinahrpglqekrkveqlqynlelafhhhlckthrqsilaklppkgklrslcsqhver
    lqifqhlhpivvqaafpplykelfs
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgqB (B:)
    aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
    teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
    melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
    nlelafhhhlckthrqsilaklppkgklrslcsq