PDB entry 6fgd

View 6fgd on RCSB PDB site
Description: Crystal structure of Gephyrin E domain in complex with Artemether
Class: structural protein
Keywords: Antimalarial compound, scaffolding protein, moonlighting protein, inhibitory neurotransmission, STRUCTURAL PROTEIN
Deposited on 2018-01-10, released 2019-01-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-16, with a file datestamp of 2019-01-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gephyrin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gphn, Gph
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fgda1, d6fgda2, d6fgda3
  • Heterogens: CA, PO4, ACT, NA, ADP, MPD, D8Z, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fgdA (A:)
    mspfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgya
    vraadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresd
    dgteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnk
    fpvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllna
    lnegisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgv
    rkiifalpgnpvsavvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhrci
    ltwhhqeplpwaqstgnqmssrlmsmrsangllmlppkteqyvelhkgevvdvmvigrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fgdA (A:)
    spfpltsmdkafitvlemtpvlgteiinyrdgmgrvlaqdvyakdnlppfpasvkdgyav
    raadgpgdrfiigesqageqptqtvmpgqvmrvttgapipcgadavvqvedteliresdd
    gteelevrilvqarpgqdirpighdikrgecvlakgthmgpseigllatvgvtevevnkf
    pvvavmstgnellnpeddllpgkirdsnrstllatiqehgyptinlgivgdnpddllnal
    negisradviitsggvsmgekdylkqvldidlhaqihfgrvfmkpglpttfatldidgvr
    kiifalpgnpvsavvtcnlfvvpalrkmqgildprptiikarlscdvkldprpeyhrcil
    twhhqeplpwaqstsrlmsmrsangllmlppkteqyvelhkgevvdvmvigrl