PDB entry 6fg1

View 6fg1 on RCSB PDB site
Description: crystal structure of fab of natalizumab in complex with fab of naa32.
Class: immune system
Keywords: antibody, immune system
Deposited on 2018-01-09, released 2019-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heavy chain of fab naa32
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6FG1 (0-End)
  • Chain 'D':
    Compound: light chain of fab naa32
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6FG1 (0-End)
    Domains in SCOPe 2.07: d6fg1d1, d6fg1d2
  • Chain 'H':
    Compound: heavy chain of fab natalizumab
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6FG1 (0-End)
  • Chain 'L':
    Compound: light chain of fab natalizumab
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 6FG1 (0-End)
    Domains in SCOPe 2.07: d6fg1l1, d6fg1l2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fg1D (D:)
    eivmtqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygastratgipa
    rfsgsgsgteftltisslqsedfavyycqqynnwppltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevtheglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fg1D (D:)
    eivmtqspatlsvspgeratlscrasqsvssnlawyqqkpgqaprlliygastratgipa
    rfsgsgsgteftltisslqsedfavyycqqynnwppltfgggtkveikrtvaapsvfifp
    psdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevtheglsspvtksfnrg
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6fg1L (L:)
    diqmtqspsslsasvgdrvtitcktsqdinkymawyqqtpgkaprllihytsalqpgips
    rfsgsgsgrdytftisslqpediatyyclqydnlwtfgqgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fg1L (L:)
    diqmtqspsslsasvgdrvtitcktsqdinkymawyqqtpgkaprllihytsalqpgips
    rfsgsgsgrdytftisslqpediatyyclqydnlwtfgqgtkveikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnrg