PDB entry 6fer

View 6fer on RCSB PDB site
Description: Crystal Structure of human DDR2 kinase in complex with 2-[4,5-difluoro-2-oxo-1'-(1H-pyrazolo[3,4-b]pyridine-5-carbonyl)spiro[indole-3,4'-piperidine]-1-yl]-N-(2,2,2-trifluoroethyl)acetamide
Class: transferase
Keywords: rtk, receptor tyrosine kinase, collagen, discoidin domain;, transferase
Deposited on 2018-01-03, released 2018-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-28, with a file datestamp of 2018-11-23.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Discoidin domain-containing receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR2, NTRKR3, TKT, TYRO10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fera_
  • Chain 'B':
    Compound: Discoidin domain-containing receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR2, NTRKR3, TKT, TYRO10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ferb_
  • Chain 'C':
    Compound: Discoidin domain-containing receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR2, NTRKR3, TKT, TYRO10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ferc_
  • Chain 'D':
    Compound: Discoidin domain-containing receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR2, NTRKR3, TKT, TYRO10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ferd_
  • Chain 'E':
    Compound: Discoidin domain-containing receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR2, NTRKR3, TKT, TYRO10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fere_
  • Chain 'F':
    Compound: Discoidin domain-containing receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR2, NTRKR3, TKT, TYRO10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ferf_
  • Chain 'G':
    Compound: Discoidin domain-containing receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR2, NTRKR3, TKT, TYRO10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ferg_
  • Chain 'H':
    Compound: Discoidin domain-containing receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR2, NTRKR3, TKT, TYRO10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ferh_
  • Chain 'I':
    Compound: Discoidin domain-containing receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR2, NTRKR3, TKT, TYRO10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6feri_
  • Chain 'J':
    Compound: Discoidin domain-containing receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR2, NTRKR3, TKT, TYRO10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ferj_
  • Chain 'K':
    Compound: Discoidin domain-containing receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR2, NTRKR3, TKT, TYRO10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ferk_
  • Chain 'L':
    Compound: Discoidin domain-containing receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: DDR2, NTRKR3, TKT, TYRO10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ferl_
  • Heterogens: D6Q

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ferA (A:)
    vaveefprklltfkeklgegqfgevhlcevegmekfkdkdfaldvsanqpvlvavkmlra
    danknarndflkeikimsrlkdpniihllavcitddplcmiteymengdlnqflsrhepp
    nssssdvrtvsytnlkfmatqiasgmkylsslnfvhrdlatrnclvgknytikiadfgms
    rnlysgdyyriqgravlpirwmswesillgkfttasdvwafgvtlwetftfcqeqpysql
    sdeqvientgeffrdqgrqtylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllqq
    gdehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ferA (A:)
    vaveefprklltfkeklgegqfgevhlcevegpvlvavkmlradanknarndflkeikim
    srlkdpniihllavcitddplcmiteymengdlnqflsrhtvsytnlkfmatqiasgmky
    lsslnfvhrdlatrnclvgknytikiadfgmsrnlysgdyyriqgravlpirwmswesil
    lgkfttasdvwafgvtlwetftfcqeqpysqlsdeqvientgeffrdqgrqtylpqpaic
    pdsvyklmlscwrrdtknrpsfqeihllllq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ferB (B:)
    vaveefprklltfkeklgegqfgevhlcevegmekfkdkdfaldvsanqpvlvavkmlra
    danknarndflkeikimsrlkdpniihllavcitddplcmiteymengdlnqflsrhepp
    nssssdvrtvsytnlkfmatqiasgmkylsslnfvhrdlatrnclvgknytikiadfgms
    rnlysgdyyriqgravlpirwmswesillgkfttasdvwafgvtlwetftfcqeqpysql
    sdeqvientgeffrdqgrqtylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllqq
    gdehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ferB (B:)
    vaveefprklltfkeklgegqfgevhlcevvlvavkmlradanknarndflkeikimsrl
    kdpniihllavcitddplcmiteymengdlnqflsrheppnssssdvrtvsytnlkfmat
    qiasgmkylsslnfvhrdlatrnclvgknytikiadfgmsrnlysgdyyriqgravlpir
    wmswesillgkfttasdvwafgvtlwetftfcqeqpysqlsdeqvientgeffrdqgrqt
    ylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ferC (C:)
    vaveefprklltfkeklgegqfgevhlcevegmekfkdkdfaldvsanqpvlvavkmlra
    danknarndflkeikimsrlkdpniihllavcitddplcmiteymengdlnqflsrhepp
    nssssdvrtvsytnlkfmatqiasgmkylsslnfvhrdlatrnclvgknytikiadfgms
    rnlysgdyyriqgravlpirwmswesillgkfttasdvwafgvtlwetftfcqeqpysql
    sdeqvientgeffrdqgrqtylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllqq
    gdehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ferC (C:)
    vaveefprklltfkeklgegqfgevhlcevegpvlvavkmlradanknarndflkeikim
    srlkdpniihllavcitddplcmiteymengdlnqflsrhetvsytnlkfmatqiasgmk
    ylsslnfvhrdlatrnclvgknytikiadfgmsrnlysgdyyriqgravlpirwmswesi
    llgkfttasdvwafgvtlwetftfcqeqpysqlsdeqvientgeffrdqgrqtylpqpai
    cpdsvyklmlscwrrdtknrpsfqeihllllq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ferD (D:)
    vaveefprklltfkeklgegqfgevhlcevegmekfkdkdfaldvsanqpvlvavkmlra
    danknarndflkeikimsrlkdpniihllavcitddplcmiteymengdlnqflsrhepp
    nssssdvrtvsytnlkfmatqiasgmkylsslnfvhrdlatrnclvgknytikiadfgms
    rnlysgdyyriqgravlpirwmswesillgkfttasdvwafgvtlwetftfcqeqpysql
    sdeqvientgeffrdqgrqtylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllqq
    gdehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ferD (D:)
    vaveefprklltfkeklgegqfgevhlcevpvlvavkmlradanknarndflkeikimsr
    lkdpniihllavcitddplcmiteymengdlnqflsrheppnssssdvrtvsytnlkfma
    tqiasgmkylsslnfvhrdlatrnclvgknytikiadfgmsrnlysgdyyriqgravlpi
    rwmswesillgkfttasdvwafgvtlwetftfcqeqpysqlsdeqvientgeffrdqgrq
    tylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6ferE (E:)
    vaveefprklltfkeklgegqfgevhlcevegmekfkdkdfaldvsanqpvlvavkmlra
    danknarndflkeikimsrlkdpniihllavcitddplcmiteymengdlnqflsrhepp
    nssssdvrtvsytnlkfmatqiasgmkylsslnfvhrdlatrnclvgknytikiadfgms
    rnlysgdyyriqgravlpirwmswesillgkfttasdvwafgvtlwetftfcqeqpysql
    sdeqvientgeffrdqgrqtylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllqq
    gdehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ferE (E:)
    vaveefprklltfkeklgegqfgevhlcevepvlvavkmlradanknarndflkeikims
    rlkdpniihllavcitddplcmiteymengdlnqflsrheprtvsytnlkfmatqiasgm
    kylsslnfvhrdlatrnclvgknytikiadfgmsrnlysgdyyriqgravlpirwmswes
    illgkfttasdvwafgvtlwetftfcqeqpysqlsdeqvientgeffrdqgrqtylpqpa
    icpdsvyklmlscwrrdtknrpsfqeihllllq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6ferF (F:)
    vaveefprklltfkeklgegqfgevhlcevegmekfkdkdfaldvsanqpvlvavkmlra
    danknarndflkeikimsrlkdpniihllavcitddplcmiteymengdlnqflsrhepp
    nssssdvrtvsytnlkfmatqiasgmkylsslnfvhrdlatrnclvgknytikiadfgms
    rnlysgdyyriqgravlpirwmswesillgkfttasdvwafgvtlwetftfcqeqpysql
    sdeqvientgeffrdqgrqtylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllqq
    gdehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ferF (F:)
    vaveefprklltfkeklgegqfgevhlcevegnqpvlvavkmlradanknarndflkeik
    imsrlkdpniihllavcitddplcmiteymengdlnqflsrheptvsytnlkfmatqias
    gmkylsslnfvhrdlatrnclvgknytikiadfgmsrnlysgdyyriqgravlpirwmsw
    esillgkfttasdvwafgvtlwetftfcqeqpysqlsdeqvientgeffrdqgrqtylpq
    paicpdsvyklmlscwrrdtknrpsfqeihllllq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6ferG (G:)
    vaveefprklltfkeklgegqfgevhlcevegmekfkdkdfaldvsanqpvlvavkmlra
    danknarndflkeikimsrlkdpniihllavcitddplcmiteymengdlnqflsrhepp
    nssssdvrtvsytnlkfmatqiasgmkylsslnfvhrdlatrnclvgknytikiadfgms
    rnlysgdyyriqgravlpirwmswesillgkfttasdvwafgvtlwetftfcqeqpysql
    sdeqvientgeffrdqgrqtylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllqq
    gdehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ferG (G:)
    vaveefprklltfkeklgegqfgevhlcevegpvlvavkmlradanknarndflkeikim
    srlkdpniihllavcitddplcmiteymengdlnqflsrhertvsytnlkfmatqiasgm
    kylsslnfvhrdlatrnclvgknytikiadfgmsrnlysgdyyriqgravlpirwmswes
    illgkfttasdvwafgvtlwetftfcqeqpysqlsdeqvientgeffrdqgrqtylpqpa
    icpdsvyklmlscwrrdtknrpsfqeihllllq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6ferH (H:)
    vaveefprklltfkeklgegqfgevhlcevegmekfkdkdfaldvsanqpvlvavkmlra
    danknarndflkeikimsrlkdpniihllavcitddplcmiteymengdlnqflsrhepp
    nssssdvrtvsytnlkfmatqiasgmkylsslnfvhrdlatrnclvgknytikiadfgms
    rnlysgdyyriqgravlpirwmswesillgkfttasdvwafgvtlwetftfcqeqpysql
    sdeqvientgeffrdqgrqtylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllqq
    gdehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ferH (H:)
    vaveefprklltfkeklgegqfgevhlcevpvlvavkmlradanknarndflkeikimsr
    lkdpniihllavcitddplcmiteymengdlnqflsrheprtvsytnlkfmatqiasgmk
    ylsslnfvhrdlatrnclvgknytikiadfgmsrnlysgdyyriqgravlpirwmswesi
    llgkfttasdvwafgvtlwetftfcqeqpysqlsdeqvientgeffrdqgrqtylpqpai
    cpdsvyklmlscwrrdtknrpsfqeihllllq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >6ferI (I:)
    vaveefprklltfkeklgegqfgevhlcevegmekfkdkdfaldvsanqpvlvavkmlra
    danknarndflkeikimsrlkdpniihllavcitddplcmiteymengdlnqflsrhepp
    nssssdvrtvsytnlkfmatqiasgmkylsslnfvhrdlatrnclvgknytikiadfgms
    rnlysgdyyriqgravlpirwmswesillgkfttasdvwafgvtlwetftfcqeqpysql
    sdeqvientgeffrdqgrqtylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllqq
    gdehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ferI (I:)
    veefprklltfkeklgegqfgevhlcevvlvavkmlradanknarndflkeikimsrlkd
    pniihllavcitddplcmiteymengdlnqflsrhepvsytnlkfmatqiasgmkylssl
    nfvhrdlatrnclvgknytikiadfgmsrnlysgdyyriqgravlpirwmswesillgkf
    ttasdvwafgvtlwetftfcqeqpysqlsdeqvientgeffrdqgrqtylpqpaicpdsv
    yklmlscwrrdtknrpsfqeihllllq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6ferJ (J:)
    vaveefprklltfkeklgegqfgevhlcevegmekfkdkdfaldvsanqpvlvavkmlra
    danknarndflkeikimsrlkdpniihllavcitddplcmiteymengdlnqflsrhepp
    nssssdvrtvsytnlkfmatqiasgmkylsslnfvhrdlatrnclvgknytikiadfgms
    rnlysgdyyriqgravlpirwmswesillgkfttasdvwafgvtlwetftfcqeqpysql
    sdeqvientgeffrdqgrqtylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllqq
    gdehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ferJ (J:)
    vaveefprklltfkeklgegqfgevhlcevvlvavkmlradanknarndflkeikimsrl
    kdpniihllavcitddplcmiteymengdlnqflsrhepprtvsytnlkfmatqiasgmk
    ylsslnfvhrdlatrnclvgknytikiadfgmsrnlysgdyyriqgravlpirwmswesi
    llgkfttasdvwafgvtlwetftfcqeqpysqlsdeqvientgeffrdqgrqtylpqpai
    cpdsvyklmlscwrrdtknrpsfqeihllllq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >6ferK (K:)
    vaveefprklltfkeklgegqfgevhlcevegmekfkdkdfaldvsanqpvlvavkmlra
    danknarndflkeikimsrlkdpniihllavcitddplcmiteymengdlnqflsrhepp
    nssssdvrtvsytnlkfmatqiasgmkylsslnfvhrdlatrnclvgknytikiadfgms
    rnlysgdyyriqgravlpirwmswesillgkfttasdvwafgvtlwetftfcqeqpysql
    sdeqvientgeffrdqgrqtylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllqq
    gdehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ferK (K:)
    veefprklltfkeklgegqfgevhlcevpvlvavkmlradanknarndflkeikimsrlk
    dpniihllavcitddplcmiteymengdlnqflsrhetvsytnlkfmatqiasgmkylss
    lnfvhrdlatrnclvgknytikiadfgmsrnlysgdyyriqgravlpirwmswesillgk
    fttasdvwafgvtlwetftfcqeqpysqlsdeqvientgeffrdqgrqtylpqpaicpds
    vyklmlscwrrdtknrpsfqeihllllq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6ferL (L:)
    vaveefprklltfkeklgegqfgevhlcevegmekfkdkdfaldvsanqpvlvavkmlra
    danknarndflkeikimsrlkdpniihllavcitddplcmiteymengdlnqflsrhepp
    nssssdvrtvsytnlkfmatqiasgmkylsslnfvhrdlatrnclvgknytikiadfgms
    rnlysgdyyriqgravlpirwmswesillgkfttasdvwafgvtlwetftfcqeqpysql
    sdeqvientgeffrdqgrqtylpqpaicpdsvyklmlscwrrdtknrpsfqeihllllqq
    gdehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ferL (L:)
    aveefprklltfkeklgegqfgevhlcevvlvavkmlradanknarndflkeikimsrlk
    dpniihllavcitddplcmiteymengdlnqflsrheppnvrtvsytnlkfmatqiasgm
    kylsslnfvhrdlatrnclvgknytikiadfgmsrnlysgdyyriqgravlpirwmswes
    illgkfttasdvwafgvtlwetftfcqeqpysqlsdeqvientgeffrdqgrqtylpqpa
    icpdsvyklmlscwrrdtknrpsfqeihllllq