PDB entry 6fe4

View 6fe4 on RCSB PDB site
Description: Crystal structure of the complex between Shiga toxin Stx2 B subunit and neutralising Nb113
Class: toxin
Keywords: Toxin, Complex, Nanobody, Shiga
Deposited on 2017-12-29, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Shiga-like toxin 2 subunit B
    Species: Enterobacteria phage 933W [TaxId:10730]
    Gene: stxB2, stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09386 (0-69)
      • expression tag (70-71)
    Domains in SCOPe 2.07: d6fe4a1, d6fe4a2
  • Chain 'B':
    Compound: Shiga-like toxin 2 subunit B
    Species: Enterobacteria phage 933W [TaxId:10730]
    Gene: stxB2, stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09386 (0-69)
      • expression tag (70)
    Domains in SCOPe 2.07: d6fe4b1, d6fe4b2
  • Chain 'C':
    Compound: Shiga-like toxin 2 subunit B
    Species: Enterobacteria phage 933W [TaxId:10730]
    Gene: stxB2, stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09386 (0-69)
      • expression tag (70)
    Domains in SCOPe 2.07: d6fe4c1, d6fe4c2
  • Chain 'D':
    Compound: Shiga-like toxin 2 subunit B
    Species: Enterobacteria phage 933W [TaxId:10730]
    Gene: stxB2, stx2B, L0104
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fe4d_
  • Chain 'E':
    Compound: Shiga-like toxin 2 subunit B
    Species: Enterobacteria phage 933W [TaxId:10730]
    Gene: stxB2, stx2B, L0104
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09386 (0-69)
      • expression tag (70)
    Domains in SCOPe 2.07: d6fe4e1, d6fe4e2
  • Chain 'F':
    Compound: Nb113
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FE4 (0-End)
    Domains in SCOPe 2.07: d6fe4f1, d6fe4f2
  • Chain 'G':
    Compound: Nb113
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FE4 (0-End)
    Domains in SCOPe 2.07: d6fe4g1, d6fe4g2
  • Chain 'H':
    Compound: Nb113
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FE4 (0-End)
    Domains in SCOPe 2.07: d6fe4h1, d6fe4h2
  • Chain 'I':
    Compound: Nb113
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FE4 (0-118)
    Domains in SCOPe 2.07: d6fe4i1, d6fe4i2
  • Chain 'J':
    Compound: Nb113
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FE4 (0-End)
    Domains in SCOPe 2.07: d6fe4j1, d6fe4j2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fe4A (A:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnndle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fe4B (B:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnndle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fe4B (B:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnndl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6fe4C (C:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnndle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fe4C (C:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnndl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6fe4D (D:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnndle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fe4D (D:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnnd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6fe4E (E:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnndle
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fe4E (E:)
    adcakgkiefskyneddtftvkvdgkeywtsrwnlqpllqsaqltgmtvtiksstcesgs
    gfaevqfnndl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6fe4F (F:)
    qvqlqesggglvqpggslrlscaasgftfssyymswvrqapgkgpewvsgintggvgtry
    adsvkgrftisrdnakntlylqmnslkpedtalyycaigeggnrnywgqgtqvtvsshh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fe4F (F:)
    qvqlqesggglvqpggslrlscaasgftfssyymswvrqapgkgpewvsgintggvgtry
    adsvkgrftisrdnakntlylqmnslkpedtalyycaigeggnrnywgqgtqvtvss
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >6fe4G (G:)
    qvqlqesggglvqpggslrlscaasgftfssyymswvrqapgkgpewvsgintggvgtry
    adsvkgrftisrdnakntlylqmnslkpedtalyycaigeggnrnywgqgtqvtvsshh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fe4G (G:)
    qvqlqesggglvqpggslrlscaasgftfssyymswvrqapgkgpewvsgintggvgtry
    adsvkgrftisrdnakntlylqmnslkpedtalyycaigeggnrnywgqgtqvtvs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6fe4H (H:)
    qvqlqesggglvqpggslrlscaasgftfssyymswvrqapgkgpewvsgintggvgtry
    adsvkgrftisrdnakntlylqmnslkpedtalyycaigeggnrnywgqgtqvtvsshh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fe4H (H:)
    qvqlqesggglvqpggslrlscaasgftfssyymswvrqapgkgpewvsgintggvgtry
    adsvkgrftisrdnakntlylqmnslkpedtalyycaigeggnrnywgqgtqvtvss
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fe4I (I:)
    qvqlqesggglvqpggslrlscaasgftfssyymswvrqapgkgpewvsgintggvgtry
    adsvkgrftisrdnakntlylqmnslkpedtalyycaigeggnrnywgqgtqvtvsshh
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >6fe4J (J:)
    qvqlqesggglvqpggslrlscaasgftfssyymswvrqapgkgpewvsgintggvgtry
    adsvkgrftisrdnakntlylqmnslkpedtalyycaigeggnrnywgqgtqvtvsshh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fe4J (J:)
    qvqlqesggglvqpggslrlscaasgftfssyymswvrqapgkgpewvsgintggvgtry
    adsvkgrftisrdnakntlylqmnslkpedtalyycaigeggnrnywgqgtqvtvs