PDB entry 6fdc

View 6fdc on RCSB PDB site
Description: Crystal structure of the PDE4D catalytic domain in complex with GEBR-32a
Class: hydrolase
Keywords: PDE4, catalytic domain, inhibitor, GEBR, HYDROLASE
Deposited on 2017-12-22, released 2018-05-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-16, with a file datestamp of 2018-05-11.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fdca_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D, DPDE3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08499 (Start-335)
      • expression tag (336)
    Domains in SCOPe 2.07: d6fdcb1, d6fdcb2
  • Heterogens: ZN, MG, EDO, DD5, D5N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fdcA (A:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fdcA (A:)
    gvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtl
    itylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdv
    dhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrk
    mvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnp
    tkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwe
    twadlvhpdaqdildtlednrewyqstip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fdcB (B:)
    msiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfk
    ipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifa
    saihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkq
    rqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhc
    adlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyi
    vhplwetwadlvhpdaqdildtlednrewyqstipqahhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fdcB (B:)
    dvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlitylmtl
    edhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhpgvsn
    qflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvidivl
    atdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkplqly
    rqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwadlvh
    pdaqdildtlednrewyqstipqa