PDB entry 6fd3

View 6fd3 on RCSB PDB site
Description: Thiophosphorylated PAK3 kinase domain
Class: transferase
Keywords: kinase, thiophosphorylation, complex, ADP, phosphorylated, transferase
Deposited on 2017-12-21, released 2018-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-03, with a file datestamp of 2017-12-29.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase PAK 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PAK3, OPHN3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75914 (1-End)
      • expression tag (0)
      • engineered mutation (277)
    Domains in SCOPe 2.07: d6fd3a1, d6fd3a2
  • Heterogens: MG, ADP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fd3A (A:)
    smtdeeileklrsivsvgdpkkkytrfekigqgasgtvytaldiatgqevaikqmnlqqq
    pkkeliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqi
    aavcreclqaldflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrsxmvg
    tpywmapevvtrkaygpkvdiwslgimaiemvegeppylnenplralyliatngtpelqn
    perlsavfrdflnrclemdvdrrgsakellqhpflkldkplssltpliiaakeaiknssr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fd3A (A:)
    smtdeeileklrsivsvgdpkkkytrfekigqgasgtvytaldiatgqevaikqmnlqqq
    pkkeliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqi
    aavcreclqaldflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrsxmvg
    tpywmapevvtrkaygpkvdiwslgimaiemvegeppylnenplralyliatngtpelqn
    perlsavfrdflnrclemdvdrrgsakellqhpflkldkplssltpliiaakeaikn