PDB entry 6faz

View 6faz on RCSB PDB site
Description: Crystal structure of the GluA2 ligand-binding domain (S1S2J) in complex with the positive allosteric modulator TDPAM01 at 1.4 A resolution.
Class: membrane protein
Keywords: AMPA receptor, GluA2, Ligand-binding Domain, GluA2-S1S2J, positive allosteric modulator, membrane protein
Deposited on 2017-12-18, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (2-116)
      • expression tag (0-1)
      • linker (117-118)
    • Uniprot P19491 (119-End)
    Domains in SCOPe 2.07: d6faza1, d6faza2
  • Chain 'B':
    Compound: Glutamate receptor 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Gria2, Glur2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19491 (Start-116)
      • linker (117-118)
    • Uniprot P19491 (119-End)
    Domains in SCOPe 2.07: d6fazb_
  • Heterogens: SO4, PEG, GOL, CL, ACT, GLU, EDO, D45, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fazA (A:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lneqglldklknkwwydkgecgsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fazA (A:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lneqglldklknkwwydkgecgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fazB (B:)
    ganktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgk
    ygardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtp
    iesaedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvar
    vrkskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlk
    lneqglldklknkwwydkgecgsg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fazB (B:)
    ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
    rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
    aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
    skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklne
    qglldklknkwwydkgecgs