PDB entry 6fah

View 6fah on RCSB PDB site
Description: Molecular basis of the flavin-based electron-bifurcating caffeyl-CoA reductase reaction
Class: flavoprotein
Keywords: Acetogenic bacteria, bioenergetics, flavin-based electron bifurcation, electron-transfer protein/acyl-CoA dehydrogenase, ferredoxin, FLAVOPROTEIN
Deposited on 2017-12-15, released 2018-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 3.13 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Caffeyl-CoA reductase-Etf complex subunit CarE
    Species: Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) [TaxId:931626]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Caffeyl-CoA reductase-Etf complex subunit CarD
    Species: Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) [TaxId:931626]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fahb_
  • Chain 'C':
    Compound: Caffeyl-CoA reductase-Etf complex subunit CarC
    Species: Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) [TaxId:931626]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fahc1, d6fahc2
  • Chain 'D':
    Compound: Caffeyl-CoA reductase-Etf complex subunit CarC
    Species: Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) [TaxId:931626]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fahd1, d6fahd2
  • Chain 'E':
    Compound: Caffeyl-CoA reductase-Etf complex subunit CarE
    Species: Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) [TaxId:931626]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Caffeyl-CoA reductase-Etf complex subunit CarD
    Species: Acetobacterium woodii (strain ATCC 29683 / DSM 1030 / JCM 2381 / KCTC 1655 / WB1) [TaxId:931626]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fahf_
  • Heterogens: FAD, SF4, SO4

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fahB (B:)
    mrilvcakqvpdtnevkidpktgtmiregvpsilnpddanaleaalvikdenpgtevivm
    tmgppqasemlreclamgadeayllsdrafggadtwatsatlaagikkvkkvdlvlagrq
    aidgdtaqvgsqiaqrlkmpvvtyvedikiedkkaivhrqmedgyevievqlpclltcvk
    elndprymsvggimdayeqpitiwnhediglspeacglnasptqvfrsfsppakgggemi
    tgttvnevagslvsklkekhii
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fahC (C:)
    myfseqnkmirklardfaekeltteildeveesgefpqeildkmakfgffgikipkslgg
    sggdhmsyvicmeefarvsgvasvylsspnslaggplllsgteeqiekylkpiitgkkkl
    afaltepgagsdaggmsttavdmgdyyllngrktfitmaplcddaviyaktdmskgtrgi
    safivdlksegvsmgknehkmgligcatsdiimedvkvpkenrlgevnkgfsnamktldv
    grlgvasqsigvaqgaldeaikyakerkqfgkriadfqaiafmiadmatkleaakllvyn
    aaslmdnkknatkeasmakfyaseicneicakavqihggygyikeykvermyrdcrvfti
    yegtsqvqqmvisgmllkk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fahD (D:)
    myfseqnkmirklardfaekeltteildeveesgefpqeildkmakfgffgikipkslgg
    sggdhmsyvicmeefarvsgvasvylsspnslaggplllsgteeqiekylkpiitgkkkl
    afaltepgagsdaggmsttavdmgdyyllngrktfitmaplcddaviyaktdmskgtrgi
    safivdlksegvsmgknehkmgligcatsdiimedvkvpkenrlgevnkgfsnamktldv
    grlgvasqsigvaqgaldeaikyakerkqfgkriadfqaiafmiadmatkleaakllvyn
    aaslmdnkknatkeasmakfyaseicneicakavqihggygyikeykvermyrdcrvfti
    yegtsqvqqmvisgmllkk
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fahF (F:)
    mrilvcakqvpdtnevkidpktgtmiregvpsilnpddanaleaalvikdenpgtevivm
    tmgppqasemlreclamgadeayllsdrafggadtwatsatlaagikkvkkvdlvlagrq
    aidgdtaqvgsqiaqrlkmpvvtyvedikiedkkaivhrqmedgyevievqlpclltcvk
    elndprymsvggimdayeqpitiwnhediglspeacglnasptqvfrsfsppakgggemi
    tgttvnevagslvsklkekhii