PDB entry 6faf

View 6faf on RCSB PDB site
Description: Crystal structure of human carbonic anhydrase I in complex with the 3-(2,5-dimethylphenyl)-1-(2-hydroxy-5-sulfamoylphenyl)urea inhibitor
Class: lyase
Keywords: lyase
Deposited on 2017-12-15, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fafa_
  • Chain 'B':
    Compound: Carbonic anhydrase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fafb_
  • Heterogens: D3B, ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6fafA (A:)
    maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakei
    invghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelh
    vahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnf
    dpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnav
    pmqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fafA (A:)
    dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
    hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
    nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
    llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
    nnrptqplkgrtvrasf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6fafB (B:)
    maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakei
    invghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelh
    vahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnf
    dpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnav
    pmqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6fafB (B:)
    dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
    hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
    nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
    llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
    nnrptqplkgrtvrasf