PDB entry 6fab

View 6fab on RCSB PDB site
Description: three-dimensional structure of murine anti-p-azophenylarsonate fab 36-71. 1. x-ray crystallography, site-directed mutagenesis, and modeling of the complex with hapten
Deposited on 1991-01-17, released 1993-01-15
The last revision prior to the SCOP 1.63 freeze date was dated 1995-05-15, with a file datestamp of 1995-06-03.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.209
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fabH (H:)
    evqlqqsgvelvragssvkmsckasgytftsnginwvkqrpgqglewigynnpgngyiay
    nekfkgkttltvdkssstaymqlrsltsedsavyfcarseyyggsykfdywgqgttltvs
    sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
    dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6fabL (L:)
    diqmtqipsslsaslgdrvsiscrasqdinnflnwyqqkpdgtiklliyftsrsqsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgnalprtfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec