PDB entry 6f9r

View 6f9r on RCSB PDB site
Description: Crystal structure of human Angiotensin-1 converting enzyme N-domain in complex with Sampatrilat-Asp.
Class: hydrolase
Keywords: Angiotensin-1 converting enzyme, ACE inhibitor, Sampatrilat-Asp, Sampatrilat, HYDROLASE
Deposited on 2017-12-15, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiotensin-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: ACE, DCP, DCP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821 (0-End)
      • conflict (8)
      • conflict (24)
      • conflict (81)
      • conflict (116)
      • conflict (288)
      • conflict (544)
      • conflict (575)
    Domains in SCOPe 2.07: d6f9ra_
  • Chain 'B':
    Compound: angiotensin-converting enzyme
    Species: Homo sapiens [TaxId:9606]
    Gene: ACE, DCP, DCP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12821 (0-End)
      • conflict (8)
      • conflict (24)
      • conflict (81)
      • conflict (116)
      • conflict (288)
      • conflict (544)
      • conflict (575)
    Domains in SCOPe 2.07: d6f9rb_
  • Heterogens: NAG, FUC, BMA, ZN, D0W, CL, PEG, PG4, MG, EDO, ACT, PE8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f9rA (A:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypegidlvtdeaeaskfveeydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f9rA (A:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvcltatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftalsn
    eaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryin
    lrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeeffts
    lelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhem
    ghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdin
    yllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrneth
    fdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkv
    lragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhppl
    pdnypeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f9rB (B:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedfta
    lsneaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdr
    yinlrgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeef
    ftslelspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvh
    hemghiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtes
    dinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrn
    ethfdagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagakl
    rkvlragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwh
    pplpdnypegidlvtdeaeaskfveeydl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f9rB (B:)
    ldpglqpgqfsadeagaqlfaqsyqssaeqvlfqsvaaswahdtnitaenarrqeeaall
    sqefaeawgqkakelyepiwqqftdpqlrriigavrtlgsanlplakrqqynallsqmsr
    iystakvclatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftalsne
    aykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryinl
    rgpipahllgdmwaqsweniydmvvpfpdkpnldvtstmlqqgwqathmfrvaeefftsl
    elspmppefwegsmlekpadgrevvchasawdfynrkdfrikqctrvtmdqlstvhhemg
    hiqyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvtndtesdiny
    llkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrnethf
    dagakfhvpnvtpyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkvl
    ragssrpwqevlkdmvgldaldaqpllkyfqlvtqwlqeqnqqngevlgwpeyqwhpplp
    dnyp