PDB entry 6f9q

View 6f9q on RCSB PDB site
Description: Binary complex of a 7S-cis-cis-nepetalactol cyclase from Nepeta mussinii with NAD+
Class: biosynthetic protein
Keywords: iridoid, natural product, biosynthesis, short chain dehydrogenase, cyclase, biosynthetic protein
Deposited on 2017-12-15, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 7S-cis-cis-nepetalactol cyclase
    Species: Nepeta racemosa [TaxId:213401]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F9Q
    Domains in SCOPe 2.07: d6f9qa_
  • Chain 'B':
    Compound: 7S-cis-cis-nepetalactol cyclase
    Species: Nepeta racemosa [TaxId:213401]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F9Q
    Domains in SCOPe 2.07: d6f9qb_
  • Chain 'C':
    Compound: 7S-cis-cis-nepetalactol cyclase
    Species: Nepeta racemosa [TaxId:213401]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F9Q
    Domains in SCOPe 2.07: d6f9qc_
  • Chain 'D':
    Compound: 7S-cis-cis-nepetalactol cyclase
    Species: Nepeta racemosa [TaxId:213401]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F9Q
    Domains in SCOPe 2.07: d6f9qd_
  • Heterogens: NAD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f9qA (A:)
    gpmannsvmmkkklegkvaivtggasgigeatarlfvkygaravviadiqselgrsvaes
    igkercsfvqcdvadeeqvksmiewtattyggldvmfsnagvlnsaaqtvkdldlplfdk
    vmrvntrgaavcvkqaarkmvelgrggsiicnagssavrgahgvtdyvmskhaviglvrs
    asmqlgahsirvnsvspmavatpltrnqgistpddvqkflmpfislkgvpptaeqvaeaa
    aflgsdeaafvtghdlpvdggvlcmpfllgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f9qA (A:)
    kkklegkvaivtggasgigeatarlfvkygaravviadiqselgrsvaesigkercsfvq
    cdvadeeqvksmiewtattyggldvmfsnagvlnsaaqtvkdldlplfdkvmrvntrgaa
    vcvkqaarkmvelgrggsiicnagssavrgahgvtdyvmskhaviglvrsasmqlgahsi
    rvnsvspmavatpltrnqgistpddvqkflmpfislkgvpptaeqvaeaaaflgsdeaaf
    vtghdlpvdggvlcmpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f9qB (B:)
    gpmannsvmmkkklegkvaivtggasgigeatarlfvkygaravviadiqselgrsvaes
    igkercsfvqcdvadeeqvksmiewtattyggldvmfsnagvlnsaaqtvkdldlplfdk
    vmrvntrgaavcvkqaarkmvelgrggsiicnagssavrgahgvtdyvmskhaviglvrs
    asmqlgahsirvnsvspmavatpltrnqgistpddvqkflmpfislkgvpptaeqvaeaa
    aflgsdeaafvtghdlpvdggvlcmpfllgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f9qB (B:)
    kkklegkvaivtggasgigeatarlfvkygaravviadiqselgrsvaesigkercsfvq
    cdvadeeqvksmiewtattyggldvmfsnagvlnsaaqtvkdldlplfdkvmrvntrgaa
    vcvkqaarkmvelgrggsiicnagssavrgahgvtdyvmskhaviglvrsasmqlgahsi
    rvnsvspmavatpltrnqgistpddvqkflmpfislkgvpptaeqvaeaaaflgsdeaaf
    vtghdlpvdggvlcmpf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6f9qC (C:)
    gpmannsvmmkkklegkvaivtggasgigeatarlfvkygaravviadiqselgrsvaes
    igkercsfvqcdvadeeqvksmiewtattyggldvmfsnagvlnsaaqtvkdldlplfdk
    vmrvntrgaavcvkqaarkmvelgrggsiicnagssavrgahgvtdyvmskhaviglvrs
    asmqlgahsirvnsvspmavatpltrnqgistpddvqkflmpfislkgvpptaeqvaeaa
    aflgsdeaafvtghdlpvdggvlcmpfllgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f9qC (C:)
    mmkkklegkvaivtggasgigeatarlfvkygaravviadiqselgrsvaesigkercsf
    vqcdvadeeqvksmiewtattyggldvmfsnagvlnsaaqtvkdldlplfdkvmrvntrg
    aavcvkqaarkmvelgrggsiicnagssavrgahgvtdyvmskhaviglvrsasmqlgah
    sirvnsvspmavatpltrnqgistpddvqkflmpfislkgvpptaeqvaeaaaflgsdea
    afvtghdlpvdggvlcmpfl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6f9qD (D:)
    gpmannsvmmkkklegkvaivtggasgigeatarlfvkygaravviadiqselgrsvaes
    igkercsfvqcdvadeeqvksmiewtattyggldvmfsnagvlnsaaqtvkdldlplfdk
    vmrvntrgaavcvkqaarkmvelgrggsiicnagssavrgahgvtdyvmskhaviglvrs
    asmqlgahsirvnsvspmavatpltrnqgistpddvqkflmpfislkgvpptaeqvaeaa
    aflgsdeaafvtghdlpvdggvlcmpfllgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f9qD (D:)
    kkklegkvaivtggasgigeatarlfvkygaravviadiqselgrsvaesigkercsfvq
    cdvadeeqvksmiewtattyggldvmfsnagvlnsaaqtvkdldlplfdkvmrvntrgaa
    vcvkqaarkmvelgrggsiicnagssavrgahgvtdyvmskhaviglvrsasmqlgahsi
    rvnsvspmavatpltrnqgistpddvqkflmpfislkgvpptaeqvaeaaaflgsdeaaf
    vtghdlpvdggvlcmpfl