PDB entry 6f9j

View 6f9j on RCSB PDB site
Description: Crystal structure of Barley Beta-Amylase complexed with 4-O-alpha-D-mannopyranosyl-(1-deoxynojirimycin)
Class: hydrolase
Keywords: Edible Grain, Endosperm, Enzyme Inhibitors, Models, Molecular, Molecular Conformation, Starch, Structure-Activity Relationship, beta-Amylase, HYDROLASE
Deposited on 2017-12-14, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-amylase
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8CFR3
      • variant (164)
    Domains in SCOPe 2.07: d6f9ja_
  • Heterogens: NOJ, MAN, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f9jA (A:)
    mevnvkgnyvqvyvmlpldavsvnnrfekgdelraqlrklveagvdgvmvdvwwglvegk
    gpkaydwsaykqlfelvqkaglklqaimsfhqcggnvgdavnipipqwvrdvgtrdpdif
    ytdghgtrnieyltlgvdnqplfhgrsavqmyadymtsfrenmkefldagvivdievglg
    pagemrypsypqshgwsfpgigeficydkylqadfkaaaaavghpewefpndvgqyndtp
    ertqffrdngtylsekgrfflawysnnlikhgdrildeankvflgykvqlaikisgihww
    ykvpshaaeltagyynlhdrdgyrtiarmlkrhrasinftcaemrdseqssqamsapeel
    vqqvlsagwreglnvacenalprydptayntilrnarphginqsgppehklfgftylrls
    nqlvegqnyvnfktfvdrmhanlprdpyvdpmaplprsgpeisiemilqaaqpklqpfpf
    qehtdlpvgptggmggqaegptcgmggqvkgptggmggqaedptsgmggelpatm
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f9jA (A:)
    vkgnyvqvyvmlpldavsvnnrfekgdelraqlrklveagvdgvmvdvwwglvegkgpka
    ydwsaykqlfelvqkaglklqaimsfhqcggnvgdavnipipqwvrdvgtrdpdifytdg
    hgtrnieyltlgvdnqplfhgrsavqmyadymtsfrenmkefldagvivdievglgpage
    mrypsypqshgwsfpgigeficydkylqadfkaaaaavghpewefpndvgqyndtpertq
    ffrdngtylsekgrfflawysnnlikhgdrildeankvflgykvqlaikisgihwwykvp
    shaaeltagyynlhdrdgyrtiarmlkrhrasinftcaemrdseqssqamsapeelvqqv
    lsagwreglnvacenalprydptayntilrnarphginqsgppehklfgftylrlsnqlv
    egqnyvnfktfvdrmhanlprdpyvdpmaplprsgpeisiemilqaaqpklqpfpfqeht
    dlpvg