PDB entry 6f7h

View 6f7h on RCSB PDB site
Description: Crystal structure of human AQP10
Class: transport protein
Keywords: glycerol, TRANSPORT PROTEIN, Aquaporin
Deposited on 2017-12-08, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aquaporin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: AQP10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f7ha_
  • Chain 'B':
    Compound: Aquaporin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: AQP10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f7hb_
  • Chain 'C':
    Compound: Aquaporin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: AQP10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f7hc_
  • Chain 'D':
    Compound: Aquaporin-10
    Species: Homo sapiens [TaxId:9606]
    Gene: AQP10
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f7hd_
  • Heterogens: BNG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f7hA (A:)
    mvftqapaeimghlrirsllarqclaeflgvfvlmlltqgavaqavtsgetkgnfftmfl
    agslavtiaiyvggnvsgahlnpafslamcivgrlpwvklpiyilvqllsafcasgatyv
    lyhdalqnytggnltvtgpketasifatypapylslnngfldqvlgtgmlivgllaildr
    rnkgvpaglepvvvgmlilalglsmgancgiplnpardlgprlftyvagwgpevfsagng
    wwwvpvvaplvgatvgtatyqllvalhhpegpepaqdlvsaqhkaseletpasaqmleck
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f7hA (A:)
    sllarqclaeflgvfvlmlltqgavaqavtsgetkgnfftmflagslavtiaiyvggnvs
    gahlnpafslamcivgrlpwvklpiyilvqllsafcasgatyvlyhdalqnytggnltvt
    gpketasifatypapylslnngfldqvlgtgmlivgllaildrrnkgvpaglepvvvgml
    ilalglsmgancgiplnpardlgprlftyvagwgpevfsagngwwwvpvvaplvgatvgt
    atyqllvalhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f7hB (B:)
    mvftqapaeimghlrirsllarqclaeflgvfvlmlltqgavaqavtsgetkgnfftmfl
    agslavtiaiyvggnvsgahlnpafslamcivgrlpwvklpiyilvqllsafcasgatyv
    lyhdalqnytggnltvtgpketasifatypapylslnngfldqvlgtgmlivgllaildr
    rnkgvpaglepvvvgmlilalglsmgancgiplnpardlgprlftyvagwgpevfsagng
    wwwvpvvaplvgatvgtatyqllvalhhpegpepaqdlvsaqhkaseletpasaqmleck
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f7hB (B:)
    sllarqclaeflgvfvlmlltqgavaqavtsgetkgnfftmflagslavtiaiyvggnvs
    gahlnpafslamcivgrlpwvklpiyilvqllsafcasgatyvlyhdalqnytggnltvt
    gpketasifatypapylslnngfldqvlgtgmlivgllaildrrnkgvpaglepvvvgml
    ilalglsmgancgiplnpardlgprlftyvagwgpevfsagngwwwvpvvaplvgatvgt
    atyqllvalhhp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6f7hC (C:)
    mvftqapaeimghlrirsllarqclaeflgvfvlmlltqgavaqavtsgetkgnfftmfl
    agslavtiaiyvggnvsgahlnpafslamcivgrlpwvklpiyilvqllsafcasgatyv
    lyhdalqnytggnltvtgpketasifatypapylslnngfldqvlgtgmlivgllaildr
    rnkgvpaglepvvvgmlilalglsmgancgiplnpardlgprlftyvagwgpevfsagng
    wwwvpvvaplvgatvgtatyqllvalhhpegpepaqdlvsaqhkaseletpasaqmleck
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f7hC (C:)
    irsllarqclaeflgvfvlmlltqgavaqavtsgetkgnfftmflagslavtiaiyvggn
    vsgahlnpafslamcivgrlpwvklpiyilvqllsafcasgatyvlyhdalqnytggnlt
    vtgpketasifatypapylslnngfldqvlgtgmlivgllaildrrnkgvpaglepvvvg
    mlilalglsmgancgiplnpardlgprlftyvagwgpevfsagngwwwvpvvaplvgatv
    gtatyqllvalhh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6f7hD (D:)
    mvftqapaeimghlrirsllarqclaeflgvfvlmlltqgavaqavtsgetkgnfftmfl
    agslavtiaiyvggnvsgahlnpafslamcivgrlpwvklpiyilvqllsafcasgatyv
    lyhdalqnytggnltvtgpketasifatypapylslnngfldqvlgtgmlivgllaildr
    rnkgvpaglepvvvgmlilalglsmgancgiplnpardlgprlftyvagwgpevfsagng
    wwwvpvvaplvgatvgtatyqllvalhhpegpepaqdlvsaqhkaseletpasaqmleck
    l
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f7hD (D:)
    hlrirsllarqclaeflgvfvlmlltqgavaqavtsgetkgnfftmflagslavtiaiyv
    ggnvsgahlnpafslamcivgrlpwvklpiyilvqllsafcasgatyvlyhdalqnytgg
    nltvtgpketasifatypapylslnngfldqvlgtgmlivgllaildrrnkgvpaglepv
    vvgmlilalglsmgancgiplnpardlgprlftyvagwgpevfsagngwwwvpvvaplvg
    atvgtatyqllvalhh