PDB entry 6f7g

View 6f7g on RCSB PDB site
Description: Tryptophan Repressor TrpR from E.coli with 5-Methyltryptamine
Class: transcription
Keywords: Ligand Binding, TRANSCRIPTION
Deposited on 2017-12-08, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trp operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: trpR, rtrY, b4393, JW4356
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f7ga_
  • Chain 'C':
    Compound: trp operon repressor
    Species: Escherichia coli [TaxId:562]
    Gene: trpR, rtrY, b4393, JW4356
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f7gc_
  • Heterogens: CVW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f7gA (A:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
    gemsqrelknelgagiatitrgsnslkaapvelrqwleevllk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6f7gC (C:)
    qspysaamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellr
    gemsqrelknelgagiatitrgsnslkaapvelrqwleevllk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f7gC (C:)
    aamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrgemsq
    relknelgagiatitrgsnslkaapvelrqwleevllk