PDB entry 6f5k

View 6f5k on RCSB PDB site
Description: Crystal structure of laccase from Myceliophthora thermophila
Class: oxidoreductase
Keywords: laccase, ascomycetes, oxidoreductase
Deposited on 2017-12-01, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Extracellular laccase, lcc1
    Species: Myceliophthora thermophila [TaxId:78579]
    Gene: lcc1, MYCTH_51627
    Database cross-references and differences (RAF-indexed):
    • Uniprot G2QG31 (Start-558)
      • insertion (61-64)
      • conflict (65)
      • conflict (544)
    Domains in SCOPe 2.07: d6f5ka1, d6f5ka2, d6f5ka3
  • Heterogens: CU, CA, NAG, BMA, MAN, 2PE, OH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f5kA (A:)
    qqscntpsnracwtdgydintdyevdspdtgvvrpytltltevdnwtgpdgvvkekvmlv
    nnsiigptifadwgdtiqvtvinnletngtsihwhglhqkgtnlhdgangitecpippkg
    grkvyrfkaqqygtswyhshfsaqygngvvgaiqingpaslpydtdlgvfpisdyyyssa
    delveltknsgapfsdnvlfngtakhpetgegeyanvtltpgrrhrlrlintsvenhfqv
    slvnhtmtiiaadmvpvnamtvdslflgvgqrydvvieasrtpgnywfnvtfgggllcgg
    srnpypaaifhyagapggpptdegkapvdhncldlpnlkpvvardvplsgfakrpdntld
    vtldttgtplfvwkvngsainidwgrpvvdyvltqntsfppgynivevngadqwsywlie
    ndpgapftlphpmhlhghdfyvlgrspdespasnerhvfdpardagllsganpvrrdvtm
    lpafgwvvlafradnpgawlfhchiawhvsgglgvvyleraddlrgavsdadaddldrlc
    adwrrywptnpypksdsgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f5kA (A:)
    qscntpsnracwtdgydintdyevdspdtgvvrpytltltevdnwtgpdgvvkekvmlvn
    nsiigptifadwgdtiqvtvinnletngtsihwhglhqkgtnlhdgangitecpippkgg
    rkvyrfkaqqygtswyhshfsaqygngvvgaiqingpaslpydtdlgvfpisdyyyssad
    elveltknsgapfsdnvlfngtakhpetgegeyanvtltpgrrhrlrlintsvenhfqvs
    lvnhtmtiiaadmvpvnamtvdslflgvgqrydvvieasrtpgnywfnvtfgggllcggs
    rnpypaaifhyagapggpptdegkapvdhncldlpnlkpvvardvplsgfakrpdntldv
    tldttgtplfvwkvngsainidwgrpvvdyvltqntsfppgynivevngadqwsywlien
    dpgapftlphpmhlhghdfyvlgrspdespasnerhvfdpardagllsganpvrrdvtml
    pafgwvvlafradnpgawlfhchiawhvsgglgvvyleraddlrgavsdadaddldrlca
    dwrrywptnpypksdsgl