PDB entry 6f5a

View 6f5a on RCSB PDB site
Description: Crystal structure of H. pylori purine nucleoside phosphorylase
Class: hydrolase
Keywords: Purine nucleoside phosphorylase, H. pylori, HYDROLASE
Deposited on 2017-12-01, released 2018-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Helicobacter pylori [TaxId:210]
    Gene: deoD, HP_1178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f5aa_
  • Chain 'B':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Helicobacter pylori [TaxId:210]
    Gene: deoD, HP_1178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f5ab_
  • Chain 'C':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Helicobacter pylori [TaxId:210]
    Gene: deoD, HP_1178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f5ac_
  • Chain 'D':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Helicobacter pylori [TaxId:210]
    Gene: deoD, HP_1178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f5ad_
  • Chain 'E':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Helicobacter pylori [TaxId:210]
    Gene: deoD, HP_1178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f5ae_
  • Chain 'F':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Helicobacter pylori [TaxId:210]
    Gene: deoD, HP_1178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f5af_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f5aA (A:)
    mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
    ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
    lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
    eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f5aB (B:)
    mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
    ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
    lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
    eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f5aC (C:)
    mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
    ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
    lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
    eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f5aD (D:)
    mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
    ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
    lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
    eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f5aE (E:)
    mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
    ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
    lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
    eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f5aF (F:)
    mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
    ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
    lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
    eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms