PDB entry 6f4x

View 6f4x on RCSB PDB site
Description: Crystal structure of H. pylori purine nucleoside phosphorylase in complex with PO4 and formycin A
Class: hydrolase
Keywords: Purine nucleoside phosphorylase, H. pylori, formycin A, HYDROLASE
Deposited on 2017-11-30, released 2018-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Helicobacter pylori [TaxId:210]
    Gene: deoD, HP_1178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f4xa_
  • Chain 'B':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Helicobacter pylori [TaxId:210]
    Gene: deoD, HP_1178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f4xb_
  • Chain 'C':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Helicobacter pylori [TaxId:210]
    Gene: deoD, HP_1178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f4xc_
  • Chain 'D':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Helicobacter pylori [TaxId:210]
    Gene: deoD, HP_1178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f4xd_
  • Chain 'E':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Helicobacter pylori [TaxId:210]
    Gene: deoD, HP_1178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f4xe_
  • Chain 'F':
    Compound: Purine nucleoside phosphorylase deoD-type
    Species: Helicobacter pylori [TaxId:210]
    Gene: deoD, HP_1178
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f4xf_
  • Heterogens: FMC, PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f4xA (A:)
    mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
    ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
    lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
    eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f4xB (B:)
    mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
    ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
    lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
    eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f4xC (C:)
    mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
    ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
    lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
    eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f4xD (D:)
    mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
    ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
    lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
    eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f4xE (E:)
    mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
    ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
    lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
    eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6f4xF (F:)
    mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
    ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
    lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
    eaaglyatamelnakalclcsvsdhlitkealspkervesfdnmiilalemms
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f4xF (F:)
    mtphinakigdfypqcllcgdplrvsyiakkflqdakeitnvrnmlgfsgkykgrgislm
    ghgmgiasctiyvteliktyqvkellrigtcgaispkvglkdiimatgastdsktnrvrf
    lnhdlsatpdfelslrayqtakrlgidlkvgnvfssdffysfethafdlmakynhlaiem
    eaaglyatamelnakalclcsvsdhlitkesfdnmiilalemms