PDB entry 6f4c

View 6f4c on RCSB PDB site
Description: Nicotiana benthamiana alpha-galactosidase
Class: hydrolase
Keywords: alpha-galactosidase Nicotiana benthamiana, HYDROLASE
Deposited on 2017-11-29, released 2018-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: alpha-galactosidase
    Species: Nicotiana benthamiana [TaxId:4100]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F4C (0-362)
    Domains in SCOPe 2.07: d6f4cb1, d6f4cb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6f4cB (B:)
    lsnglgrtpqmgwsswnhfacnieekeiretadamvstglaslgyeyiniddcwaelnrd
    sqgnmvpkgstfpsgikaladyvhskglklgiysdagsqtcskqmtgslgheeqdaktfa
    swgvdylkydncnnenrsprerypimakalknsgraifyslcewgdddpatwassvgnsw
    rttgdisdnwdsmtsradmndewasyagpggwndpdmlevgnggmttaeyrshfsiwala
    kapliigcdlrsmdqtaheilsnkeviavnqdklgvqgkkvkqngdlevwagplsgkrva
    lvlwnrssskaditaywsdigldsstvvdardlwahstkgsvkgqisasidshdcrmyvl
    tpk