PDB entry 6f47

View 6f47 on RCSB PDB site
Description: Crystal structure of the catalytic domain of botulinum neurotoxin X
Class: toxin
Keywords: botulinum neurotoxin, botulinum toxin, zinc endopeptidase, TOXIN
Deposited on 2017-11-29, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-28, with a file datestamp of 2018-03-23.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catalytic domain of botulinum neurotoxin X
    Species: Clostridium botulinum [TaxId:1491]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F47
    Domains in SCOPe 2.07: d6f47a1, d6f47a2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f47A (A:)
    mgsshhhhhhssglvprgshmkleinkfnyndpidginvitmrpprhsdkinkgkgpfka
    fqvikniwivperynftnntndlnipsepimeadaiynpnylntpsekdeflqgvikvle
    rikskpegekllelisssiplplvsngaltlsdnetiayqennnivsnlqanlviygpgp
    diannatyglystpisngegtlsevsfspfylkpfdesygnyrslvnivnkfvkrefapd
    pastlmhelvhvthnlygisnrnfyynfdtgkietsrqqnslifeelltfggidskaiss
    liikkiietaknnyttliserlntvtvendllkyiknkipvqgrlgnfkldtaefekkln
    tilfvlnesnlaqrfsilvrkhylkerpidpiyvnilddnsystlegfnissqgsndfqg
    qllessyfekiesnalrafikicprngllynaiyrnskn
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f47A (A:)
    mkleinkfnyndpidginvitmrpprhsdkinkgkgpfkafqvikniwivperynftnnt
    ndlnipsepimeadaiynpnylntpsekdeflqgvikvlerikskpegekllelisssip
    lplvsngaltlsdnetiayqennnivsnlqanlviygpgpdiannatyglystpisngeg
    tlsevsfspfylkpfdesygnyrslvnivnkfvkrefapdpastlmhelvhvthnlygis
    nrnfyynfdtgkietsrqqnslifeelltfggidskaissliikkiietaknnyttlise
    rlntvtvendllkyiknkipvqgrlgnfkldtaefekklntilfvlnesnlaqrfsilvr
    khylkerpidpiyvnilddnsystlegfnissqgsndfqgqllessyfekies