PDB entry 6f3b

View 6f3b on RCSB PDB site
Description: Crystal structure of human carbonic anhydrase I in complex with the 1-(2-hydroxy-5-sulfamoylphenyl)-3-[(4-methylphenyl)methyl]urea inhibitor
Class: lyase
Keywords: lyase
Deposited on 2017-11-28, released 2018-10-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-10, with a file datestamp of 2018-10-05.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f3ba_
  • Chain 'B':
    Compound: Carbonic anhydrase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6f3bb_
  • Heterogens: ZN, CJK, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f3bA (A:)
    maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakei
    invghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelh
    vahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnf
    dpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnav
    pmqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f3bA (A:)
    dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
    hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
    nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
    llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
    nnrptqplkgrtvrasf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f3bB (B:)
    maspdwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakei
    invghsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelh
    vahwnsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnf
    dpstllpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnav
    pmqhnnrptqplkgrtvrasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f3bB (B:)
    dwgyddkngpeqwsklypiangnnqspvdiktsetkhdtslkpisvsynpatakeiinvg
    hsfhvnfedndnrsvlkggpfsdsyrlfqfhfhwgstnehgsehtvdgvkysaelhvahw
    nsakysslaeaaskadglavigvlmkvgeanpklqkvldalqaiktkgkrapftnfdpst
    llpssldfwtypgslthpplyesvtwiickesisvsseqlaqfrsllsnvegdnavpmqh
    nnrptqplkgrtvrasf