PDB entry 6f2z

View 6f2z on RCSB PDB site
Description: Structure of a Fc mutatnt
Class: immune system
Keywords: antibody, monomer, BIOSYNTHETIC PROTEIN, immune system
Deposited on 2017-11-27, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fc fragment of antiboy
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F2Z
    Domains in SCOPe 2.07: d6f2za1, d6f2za2
  • Chain 'B':
    Compound: Fc fragment of antiboy
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6F2Z
    Domains in SCOPe 2.07: d6f2zb1, d6f2zb2
  • Heterogens: NAG, BMA, MAN, GAL, FUL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6f2zA (A:)
    dkthtsppspapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppsrdeltknqvslwclvkgfypsdiavewesngqpennykttppvlds
    dgsfflysaltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2zA (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvslwclvkgfypsdiavewesngqpennykttppvldsdgsfflysaltvdks
    rwqqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6f2zB (B:)
    dkthtsppspapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvd
    gvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskak
    gqprepqvytlppsrdeltknqvslwclvkgfypsdiavewesngqpennykttppvlds
    dgsfflysaltvdksrwqqgnvfscsvmhealhnhytqkslslspgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6f2zB (B:)
    gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvslwclvkgfypsdiavewesngqpennykttppvldsdgsfflysaltvdksr
    wqqgnvfscsvmhealhnhytqkslsls